prot_H-paniculata_contig9561.17278.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig9561.17278.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
RKQQLVTWSSTEAEYVAAGEAGKETVYLRELQGSIGFGCRGSTTLFEDNRSAINLSKGSGSHCRTKHIGVRWHGTREWIQEGILALKYVQTGDQLADILTKGLSRVQFQKLRNLLM*102030405060708090100110Expect = 3.22e-25 / Id = 44.35Expect = 1.96e-24 / Id = 48.18Expect = 1.74e-23 / Id = 50.89Expect = 4.19e-23 / Id = 50.48Expect = 5.55e-23 / Id = 44.74Expect = 6.68e-23 / Id = 44.35Expect = 7.84e-23 / Id = 45.22Expect = 1.26e-22 / Id = 46.96Expect = 1.42e-22 / Id = 47.41Expect = 2.08e-22 / Id = 48.21SequenceA0A5N5G5U8_9ROSAA0A4Y9ZY34_9AGAMA0A1Y1N3K4_PHOPYA0A0J7K966_LASNIUPI001AE8F203A0A0J7KNG0_LASNIA0A6G0WQK1_9STRAUPI001F04687DUPI001E1BA65CA0A7H4LDI7_WHEAT
Match NameE-valueIdentityDescription
A0A5N5G5U8_9ROSA3.220e-2544.35Uncharacterized protein n=4 Tax=Pyrus ussuriensis ... [more]
A0A4Y9ZY34_9AGAM1.960e-2448.18Integrase catalytic domain-containing protein n=1 ... [more]
A0A1Y1N3K4_PHOPY1.740e-2350.89Uncharacterized protein n=2 Tax=Photinus pyralis T... [more]
A0A0J7K966_LASNI4.190e-2350.48Copia protein n=1 Tax=Lasius niger TaxID=67767 Rep... [more]
UPI001AE8F2035.550e-2344.74secreted RxLR effector protein 161-like n=1 Tax=Le... [more]
A0A0J7KNG0_LASNI6.680e-2344.35Integrase core domain protein n=1 Tax=Lasius niger... [more]
A0A6G0WQK1_9STRA7.840e-2345.22Reverse transcriptase Ty1/copia-type domain-contai... [more]
UPI001F04687D1.260e-2246.96secreted RxLR effector protein 161-like n=1 Tax=Xe... [more]
UPI001E1BA65C1.420e-2247.41secreted RxLR effector protein 161-like n=1 Tax=Da... [more]
A0A7H4LDI7_WHEAT2.080e-2248.21Genome assembly, chromosome: II n=2 Tax=Triticinae... [more]

Pages

back to top