mRNA_H-paniculata_contig12569.1611.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: A0A8E0VLW6_9TREM (26S proteasome regulatory subunit n=1 Tax=Fasciolopsis buski TaxID=27845 RepID=A0A8E0VLW6_9TREM) HSP 1 Score: 65.5 bits (158), Expect = 1.480e-12 Identity = 30/44 (68.18%), Postives = 37/44 (84.09%), Query Frame = 1 Query: 10 YVLKRTSWVRVLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 Y+L T W V++L+DGFNGADLRNV TEAG+FAIRA+RDY +E Sbjct: 36 YLLFVTDWEAVVKLSDGFNGADLRNVCTEAGMFAIRAERDYTVE 79
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: D7G9F8_ECTSI (AAA domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G9F8_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 5.680e-12 Identity = 32/34 (94.12%), Postives = 34/34 (100.00%), Query Frame = 1 Query: 40 VLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 V++LADGFNGADLRNVGTEAGLFAIRADRDYVLE Sbjct: 336 VVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 369
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: A0A5J4N3M2_9TREM (26S proteasome regulatory subunit T4 n=2 Tax=Paragonimus TaxID=34503 RepID=A0A5J4N3M2_9TREM) HSP 1 Score: 61.2 bits (147), Expect = 3.840e-11 Identity = 27/37 (72.97%), Postives = 33/37 (89.19%), Query Frame = 1 Query: 31 WVRVLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 W V++L+DGFNGADLRNV TEAG+FAIRA+RDY +E Sbjct: 19 WEAVVKLSDGFNGADLRNVCTEAGMFAIRAERDYTVE 55
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: A0A6I9PD39_9TELE (26S protease regulatory subunit 10B n=1 Tax=Notothenia coriiceps TaxID=8208 RepID=A0A6I9PD39_9TELE) HSP 1 Score: 60.8 bits (146), Expect = 6.620e-11 Identity = 28/47 (59.57%), Postives = 37/47 (78.72%), Query Frame = 1 Query: 1 DCVYVLKRTSWVRVLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 DC + + + +++L+DGFNGADLRNV TEAGLFAIRADR+YV + Sbjct: 17 DCERLCLFSDYEAIVKLSDGFNGADLRNVCTEAGLFAIRADREYVTQ 63
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: A0A812UMP2_SYMMI (RPT4A protein n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A812UMP2_SYMMI) HSP 1 Score: 63.9 bits (154), Expect = 7.030e-11 Identity = 30/34 (88.24%), Postives = 33/34 (97.06%), Query Frame = 1 Query: 40 VLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 V++LADGFNGADLRN+ TEAGLFAIRADRDYVLE Sbjct: 189 VVKLADGFNGADLRNICTEAGLFAIRADRDYVLE 222
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: U6M7T1_EIMMA (AAA_lid_3 domain-containing protein n=1 Tax=Eimeria maxima TaxID=5804 RepID=U6M7T1_EIMMA) HSP 1 Score: 60.5 bits (145), Expect = 8.120e-11 Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = 1 Query: 22 RTSWVRVLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 R + + +L DGFNGADLRNV TEAG+FAIRADRDYV+E Sbjct: 18 RLDFDAICRLCDGFNGADLRNVCTEAGMFAIRADRDYVIE 57
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: A0A7S3H6N5_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3H6N5_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 9.120e-11 Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 40 VLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 V++LADGFNGADLRN+ TEAGLFAIR DRDYVLE Sbjct: 91 VVKLADGFNGADLRNICTEAGLFAIREDRDYVLE 124
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: A0A4Y2FGU3_ARAVE (26S proteasome regulatory subunit 10B n=1 Tax=Araneus ventricosus TaxID=182803 RepID=A0A4Y2FGU3_ARAVE) HSP 1 Score: 63.2 bits (152), Expect = 1.050e-10 Identity = 28/38 (73.68%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 28 SWVRVLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 +W V++L+DGFNGADLRNV TEAG+FAIRADR+YV+E Sbjct: 161 NWEAVVKLSDGFNGADLRNVCTEAGMFAIRADREYVVE 198
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: A0A7R9LIF8_9ACAR (Hypothetical protein n=2 Tax=Oppiidae TaxID=229795 RepID=A0A7R9LIF8_9ACAR) HSP 1 Score: 63.9 bits (154), Expect = 1.330e-10 Identity = 29/37 (78.38%), Postives = 34/37 (91.89%), Query Frame = 1 Query: 31 WVRVLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 W V++L+DGFNGADLRNV TEAGLFAIRA+RDYV+E Sbjct: 335 WEAVVKLSDGFNGADLRNVCTEAGLFAIRAERDYVIE 371
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Match: A0A7R9KL72_9ACAR (Translation machinery-associated protein 7 homolog n=1 Tax=Medioppia subpectinata TaxID=1979941 RepID=A0A7R9KL72_9ACAR) HSP 1 Score: 63.9 bits (154), Expect = 1.360e-10 Identity = 29/37 (78.38%), Postives = 34/37 (91.89%), Query Frame = 1 Query: 31 WVRVLQLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 W V++L+DGFNGADLRNV TEAGLFAIRA+RDYV+E Sbjct: 171 WEAVVKLSDGFNGADLRNVCTEAGLFAIRAERDYVIE 207 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12569.1611.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig12569.1611.1 >prot_H-paniculata_contig12569.1611.1 ID=prot_H-paniculata_contig12569.1611.1|Name=mRNA_H-paniculata_contig12569.1611.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=51bp DCVYVLKRTSWVRVLQLADGFNGADLRNVGTEAGLFAIRADRDYVLEVCVback to top mRNA from alignment at H-paniculata_contig12569:2606..2758+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig12569.1611.1 ID=mRNA_H-paniculata_contig12569.1611.1|Name=mRNA_H-paniculata_contig12569.1611.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=153bp|location=Sequence derived from alignment at H-paniculata_contig12569:2606..2758+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig12569:2606..2758+ >mRNA_H-paniculata_contig12569.1611.1 ID=mRNA_H-paniculata_contig12569.1611.1|Name=mRNA_H-paniculata_contig12569.1611.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=306bp|location=Sequence derived from alignment at H-paniculata_contig12569:2606..2758+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |