prot_H-paniculata_contig12509.1575.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12509.1575.1 vs. uniprot
Match: A0A6H5J994_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J994_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 1.300e-12 Identity = 35/58 (60.34%), Postives = 44/58 (75.86%), Query Frame = 0 Query: 1 ISACGRRGIWQESVRMLRDAREAG-----REVDVVTYSAAVAACRNGGAWPQALALLE 53 IS CGR+G W++++ +LRDA+ R VDVVTYSAAVAACR+GG W QALAL+E Sbjct: 11 ISLCGRQGGWEDAIFLLRDAQRLSSPGQLRGVDVVTYSAAVAACRDGGQWRQALALME 68
BLAST of mRNA_H-paniculata_contig12509.1575.1 vs. uniprot
Match: D7FTF0_ECTSI (PPR_long domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTF0_ECTSI) HSP 1 Score: 68.9 bits (167), Expect = 3.450e-12 Identity = 35/58 (60.34%), Postives = 44/58 (75.86%), Query Frame = 0 Query: 1 ISACGRRGIWQESVRMLRDAREAG-----REVDVVTYSAAVAACRNGGAWPQALALLE 53 IS CGR+G W+++V +LRDA+ R VDVVT+SAAVAACR+GG W QALAL+E Sbjct: 109 ISLCGRQGAWEDAVFLLRDAQRVSSPGQRRGVDVVTFSAAVAACRDGGEWRQALALME 166 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12509.1575.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig12509.1575.1 ID=prot_H-paniculata_contig12509.1575.1|Name=mRNA_H-paniculata_contig12509.1575.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=60bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|