prot_H-paniculata_contig1250.1569.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1250.1569.1 vs. uniprot
Match: D8LIK7_ECTSI (cGMP-dependent protein kinase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LIK7_ECTSI) HSP 1 Score: 79.3 bits (194), Expect = 2.500e-11 Identity = 40/62 (64.52%), Postives = 48/62 (77.42%), Query Frame = 0 Query: 711 RERLPSLPLALQSLPKEDQLYMQRNFSARKGLEAVIGLNFAALPAEVQLNMVKAMEITRYSK 772 RERLP LP ++SLPK+DQ YMQ N + RKGL AV+GLNF L AE+QL M+K M ITRY+K Sbjct: 218 RERLPPLPPHMRSLPKKDQRYMQANLALRKGLGAVVGLNFDTLTAELQLKMMKPMTITRYTK 279
BLAST of mRNA_H-paniculata_contig1250.1569.1 vs. uniprot
Match: A0A6H5L6T8_9PHAE (Cyclic nucleotide-binding domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6T8_9PHAE) HSP 1 Score: 74.7 bits (182), Expect = 3.620e-10 Identity = 38/61 (62.30%), Postives = 46/61 (75.41%), Query Frame = 0 Query: 713 RLPSLPLALQSLPKEDQLYMQRNFSARKGLEAVIGLNFAALPAEVQLNMVKAMEITRYSKV 773 RLP LP ++SL K+DQ YMQ N + RKGL AV+GLNF L AE+QL M+K M ITRY+KV Sbjct: 211 RLPPLPPHMRSLSKKDQRYMQANLALRKGLGAVVGLNFDTLSAELQLKMMKPMTITRYTKV 271 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1250.1569.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig1250.1569.1 ID=prot_H-paniculata_contig1250.1569.1|Name=mRNA_H-paniculata_contig1250.1569.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=774bpback to top |