mRNA_H-paniculata_contig12436.1528.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12436.1528.1 vs. uniprot
Match: A0A6H5JG00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JG00_9PHAE) HSP 1 Score: 118 bits (295), Expect = 2.820e-29 Identity = 50/67 (74.63%), Postives = 61/67 (91.04%), Query Frame = 1 Query: 13 RLAEDTFKQAVEADPLHSESWNGLGS-VSRDPLVQQHCWVRSVQLAHNPSAWANLGMLYIRWGLDIQ 210 R AE+ F+++VEADP +SE+WNGLG+ +S+ PLVQQHCWVRSVQL HNPSAWANLGMLY+RWG+DIQ Sbjct: 446 RSAEEAFRRSVEADPAYSEAWNGLGATMSQKPLVQQHCWVRSVQLEHNPSAWANLGMLYVRWGMDIQ 512
BLAST of mRNA_H-paniculata_contig12436.1528.1 vs. uniprot
Match: D7G059_ECTSI (Similar to Tetratricopeptide repeat protein 37 (TPR repeat protein 37) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G059_ECTSI) HSP 1 Score: 116 bits (291), Expect = 9.810e-29 Identity = 50/67 (74.63%), Postives = 60/67 (89.55%), Query Frame = 1 Query: 13 RLAEDTFKQAVEADPLHSESWNGLGS-VSRDPLVQQHCWVRSVQLAHNPSAWANLGMLYIRWGLDIQ 210 R AE+ F+++VEADP +SE+WNGLG+ +S PLVQQHCWVRSVQL HNPSAWANLGMLY+RWG+DIQ Sbjct: 967 RSAEEAFRRSVEADPAYSEAWNGLGATMSGRPLVQQHCWVRSVQLEHNPSAWANLGMLYVRWGMDIQ 1033
BLAST of mRNA_H-paniculata_contig12436.1528.1 vs. uniprot
Match: A0A3M7NBL5_9EURO (Uncharacterized protein (Fragment) n=1 Tax=Chaetothyriales sp. CBS 135597 TaxID=2249420 RepID=A0A3M7NBL5_9EURO) HSP 1 Score: 53.9 bits (128), Expect = 1.150e-6 Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 1 Query: 31 FKQAVEADPLHSESWNGLGSVSR--DPLVQQHCWVRSVQL-AHNPSAWANLGMLYI 189 FK+A+E + +SE WN LG V+ +P V QH +VRS+ L H+ W NLG+LY+ Sbjct: 922 FKRAIELEAGNSEFWNALGLVTMTLNPKVSQHSFVRSLHLNEHSARTWTNLGVLYL 977
BLAST of mRNA_H-paniculata_contig12436.1528.1 vs. uniprot
Match: A0A3M0W0G4_9EURO (Uncharacterized protein (Fragment) n=1 Tax=Chaetothyriales sp. CBS 134920 TaxID=2249417 RepID=A0A3M0W0G4_9EURO) HSP 1 Score: 52.4 bits (124), Expect = 4.020e-6 Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 1 Query: 31 FKQAVEADPLHSESWNGLGSVSR--DPLVQQHCWVRSVQLA-HNPSAWANLGMLYI 189 FK+A+E + ++E WN LG V+ +P V QH +VRS+ L H+ W NLG+LY+ Sbjct: 923 FKRAIELEAGNAEFWNALGLVTMTLNPKVSQHSFVRSLHLNDHSSRTWTNLGVLYL 978
BLAST of mRNA_H-paniculata_contig12436.1528.1 vs. uniprot
Match: A0A293MWB5_ORNER (Tetratricopeptide repeat protein 37 (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293MWB5_ORNER) HSP 1 Score: 51.6 bits (122), Expect = 7.500e-6 Identity = 25/60 (41.67%), Postives = 38/60 (63.33%), Query Frame = 1 Query: 28 TFKQAVEADPLHSESWNGLGSVS-----RDPLVQQHCWVRSVQLAH-NPSAWANLGMLYI 189 + ++AV +P +WN LG V+ ++ + QHC ++SVQL NP+AWANLG LY+ Sbjct: 487 SVQKAVSLNPADPAAWNMLGVVALAKDIKNGALAQHCLIKSVQLESCNPTAWANLGALYL 546 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12436.1528.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig12436.1528.1 >prot_H-paniculata_contig12436.1528.1 ID=prot_H-paniculata_contig12436.1528.1|Name=mRNA_H-paniculata_contig12436.1528.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=72bp MQTGRLAEDTFKQAVEADPLHSESWNGLGSVSRDPLVQQHCWVRSVQLAHback to top mRNA from alignment at H-paniculata_contig12436:249..464- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig12436.1528.1 ID=mRNA_H-paniculata_contig12436.1528.1|Name=mRNA_H-paniculata_contig12436.1528.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=216bp|location=Sequence derived from alignment at H-paniculata_contig12436:249..464- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig12436:249..464- >mRNA_H-paniculata_contig12436.1528.1 ID=mRNA_H-paniculata_contig12436.1528.1|Name=mRNA_H-paniculata_contig12436.1528.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=432bp|location=Sequence derived from alignment at H-paniculata_contig12436:249..464- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |