|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR002885 | Pentatricopeptide repeat | PFAM | PF13041 | PPR_2 | coord: 409..458
e-value: 1.8E-12
score: 47.3
coord: 234..281
e-value: 5.0E-13
score: 49.0
coord: 549..596
e-value: 7.9E-12
score: 45.2
coord: 619..666
e-value: 5.4E-10
score: 39.3
coord: 339..386
e-value: 1.0E-12
score: 48.0
coord: 168..211
e-value: 1.2E-8
score: 35.0 |
| IPR002885 | Pentatricopeptide repeat | PFAM | PF01535 | PPR | coord: 482..512
e-value: 0.0072
score: 16.5
coord: 307..337
e-value: 2.3E-4
score: 21.2
coord: 519..546
e-value: 0.0047
score: 17.1 |
| IPR002885 | Pentatricopeptide repeat | TIGRFAM | TIGR00756 | TIGR00756 | coord: 589..620
e-value: 9.8E-6
score: 23.4
coord: 272..306
e-value: 2.9E-8
score: 31.4
coord: 377..411
e-value: 8.6E-7
score: 26.8
coord: 552..586
e-value: 8.2E-9
score: 33.1
coord: 342..376
e-value: 4.3E-8
score: 30.9
coord: 237..271
e-value: 5.5E-8
score: 30.5
coord: 622..656
e-value: 7.7E-8
score: 30.0
coord: 307..341
e-value: 2.6E-6
score: 25.2
coord: 204..236
e-value: 3.5E-7
score: 28.0
coord: 412..446
e-value: 1.4E-7
score: 29.3
coord: 519..551
e-value: 3.6E-5
score: 21.7
coord: 447..481
e-value: 9.2E-6
score: 23.5
coord: 482..516
e-value: 2.3E-6
score: 25.4
coord: 168..201
e-value: 2.6E-7
score: 28.4 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 235..269
score: 12.386 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 340..374
score: 11.696 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 410..444
score: 11.477 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 655..689
score: 8.287 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 445..479
score: 11.06 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 620..654
score: 11.586 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 375..409
score: 11.29 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 165..199
score: 10.841 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 515..549
score: 11.049 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 585..619
score: 11.641 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 200..234
score: 10.918 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 480..514
score: 10.633 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 270..304
score: 12.573 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 305..339
score: 11.082 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 550..584
score: 12.375 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 103..248
e-value: 4.8E-28
score: 99.7
coord: 418..526
e-value: 5.5E-31
score: 109.3 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 249..405
e-value: 1.5E-49
score: 171.0
coord: 527..709
e-value: 3.8E-50
score: 173.0 |
| None | No IPR available | PANTHER | PTHR46128 | FAMILY NOT NAMED | coord: 148..284
coord: 283..410
coord: 220..360
coord: 442..596
coord: 333..461
coord: 581..692 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig515.12468.1 ID=prot_H-paniculata_contig515.12468.1|Name=mRNA_H-paniculata_contig515.12468.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=713bp
MVSPYSNGVAIRSMDSIRRITRKLRASSGACVPQSKTLAGCQSYCSHRAN
SVAGAHLTAAPVYINLSSLKFKGRPRDPLVQYSRNCLIRRARSSSRWMTT
DAAAHPWAKARGERLDRMGTSTSHQSRSAERRLIMQQLKEAGLQRDWQKV
EAILENVVASSNVAPLRVFNAAMSALVKSGKWEKAVDILDRMEANGAAPN
VINYTTAIKACGEGKQWEKALDLLTDMEANGITPDVVSYNTVIKACRDGG
QWERAVDLLADMEANGITPDVFSYTTAMKACGDGGQWEKAVDLLAEMEEK
GVTPNVVSYNTAMKACGVAKQWEKAVDLLPDMETKGIFPDVVSYNTAMKA
CGESKQWEKAVDLLAEMEANSITPDVVSYTTVMKVCGDGGHWEAVVDLLA
EMETRGVTPNVVSYNTAIKACGEGRQWEKALDLLTEMEAKSVIPNVVSYS
TAMKACAKSKQWETTLNLLAQMEANGVTPNAISYTTAMKACGEGKQWEKA
VDILIHMEARGIAPDVFNYNAAMKACGDSGQWEKAVNILIDMMAKGTIPD
VVSYNTAMKACGKGKQWERAVDLLAEMEANGITPDVVGYTTTIKACGDSG
QWEKAVDLLVEMEAKGVIPNSVSYNTAMHACGAAKQWEKALDLLTTMEAK
GILPDVGSYSTAIAACRSAGQLEKAGDILKDMHAQRTRASVVPSRSHIKG
NAGGSWYRTIRR* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
| Term | Definition |
|---|
| IPR002885 | Pentatricopeptide_repeat |
| IPR011990 | TPR-like_helical_dom_sf |
|