mRNA_H-paniculata_contig11883.1205.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5JUK2_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUK2_9PHAE) HSP 1 Score: 89.4 bits (220), Expect = 2.740e-18 Identity = 45/66 (68.18%), Postives = 53/66 (80.30%), Query Frame = 3 Query: 177 KVLRELGNMDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 +V +ELGNMD+T +Q+E PVETTL+ T KDA IST GKEKERFT LAVM DG+KV+P I FKGT Sbjct: 112 EVFKELGNMDQTPVQHEMPVETTLEKTGAKDARISTGGKEKERFTLVLAVMADGKKVSPRIIFKGT 177
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5JFD9_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFD9_9PHAE) HSP 1 Score: 88.6 bits (218), Expect = 3.590e-18 Identity = 45/66 (68.18%), Postives = 52/66 (78.79%), Query Frame = 3 Query: 177 KVLRELGNMDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 +V ELGNMD+T +Q+E PVETTL+ T KDA IST GKEKERFT LAVM DG+KV+P I FKGT Sbjct: 279 EVFEELGNMDQTPVQHEMPVETTLEKTGAKDARISTGGKEKERFTLVLAVMADGKKVSPRIIFKGT 344
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5K6L9_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6L9_9PHAE) HSP 1 Score: 88.6 bits (218), Expect = 6.280e-18 Identity = 45/66 (68.18%), Postives = 52/66 (78.79%), Query Frame = 3 Query: 177 KVLRELGNMDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 +V ELGNMD+T +Q+E PVETTL+ T KDA IST GKEKERFT LAVM DG+KV+P I FKGT Sbjct: 112 EVFEELGNMDQTPVQHEIPVETTLEKTGAKDARISTGGKEKERFTLVLAVMADGKKVSPRIIFKGT 177
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5KRZ8_9PHAE (DDE-1 domain-containing protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRZ8_9PHAE) HSP 1 Score: 87.0 bits (214), Expect = 2.620e-17 Identity = 44/66 (66.67%), Postives = 52/66 (78.79%), Query Frame = 3 Query: 177 KVLRELGNMDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 +V ELGNMD+T +Q+E PVETTL+ T KDA IST G+EKERFT LAVM DG+KV+P I FKGT Sbjct: 294 EVFEELGNMDQTPVQHEMPVETTLEKTGAKDARISTGGEEKERFTLVLAVMADGKKVSPRIIFKGT 359
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5JTG5_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JTG5_9PHAE) HSP 1 Score: 84.0 bits (206), Expect = 3.090e-16 Identity = 44/66 (66.67%), Postives = 51/66 (77.27%), Query Frame = 3 Query: 177 KVLRELGNMDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 +V ELGNMD+T +Q+E PVETTL+ T KDA IST GKEKERFT LAVM DG+ V+P I FKGT Sbjct: 266 EVFEELGNMDQTPVQHEMPVETTLEDTGGKDARISTGGKEKERFTLVLAVMADGKMVSPCIIFKGT 331
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5KT06_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KT06_9PHAE) HSP 1 Score: 77.0 bits (188), Expect = 2.750e-14 Identity = 39/58 (67.24%), Postives = 46/58 (79.31%), Query Frame = 3 Query: 201 MDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 MD+T +Q+E PVETTL+ T KDA IST GKE+ERF LAVM DG+KV+P ITFKGT Sbjct: 1 MDQTPVQHEMPVETTLEKTGAKDARISTGGKEQERFALVLAVMADGKKVSPRITFKGT 58
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5K583_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K583_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 4.700e-14 Identity = 43/65 (66.15%), Postives = 47/65 (72.31%), Query Frame = 3 Query: 177 KVLRELGNMDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKG 371 KV ELGNMD+T +Q E PVETTL+ VKDA IST GKEK+RFT LAVM DG KV I FKG Sbjct: 181 KVFEELGNMDQTPVQQEMPVETTLEKRGVKDARISTGGKEKDRFTPCLAVMADGGKVPQRIIFKG 245
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5L819_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L819_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 5.830e-13 Identity = 39/66 (59.09%), Postives = 47/66 (71.21%), Query Frame = 3 Query: 177 KVLRELGNMDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 +V E+G M +T +Q+E PV TL+ T KDA IST GKEKERFT LAVM DG+KV+P FKGT Sbjct: 263 EVFEEVGIMGQTPVQHEVPVAITLEKTGAKDARISTGGKEKERFTLVLAVMADGKKVSPRNIFKGT 328
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5JUV9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUV9_9PHAE) HSP 1 Score: 55.5 bits (132), Expect = 1.890e-7 Identity = 29/43 (67.44%), Postives = 32/43 (74.42%), Query Frame = 3 Query: 246 LKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 L+ T KDA IST KEKERFT LAVM DG+KV+P I FKGT Sbjct: 8 LEKTGAKDARISTGSKEKERFTLVLAVMADGKKVSPRIIFKGT 50
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Match: A0A6H5KRZ1_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRZ1_9PHAE) HSP 1 Score: 53.9 bits (128), Expect = 9.500e-6 Identity = 30/66 (45.45%), Postives = 38/66 (57.58%), Query Frame = 3 Query: 177 KVLRELGNMDRTSIQYETPVETTLKTTWVKDALISTIGKEKERFTFFLAVMNDGRKVTPHITFKGT 374 ++ ELGNMD+T +Q+ETPVE W + +ERFT LAV DG+KV I FKGT Sbjct: 236 ELFEELGNMDQTPVQHETPVERL----WKRPVRRMPASPPEERFTLCLAVSADGKKVPLRIIFKGT 297 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11883.1205.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 10
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11883.1205.1 >prot_H-paniculata_contig11883.1205.1 ID=prot_H-paniculata_contig11883.1205.1|Name=mRNA_H-paniculata_contig11883.1205.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=109bp MCDNNPESASSTGMIAEIHVAKRSAAASSVQGQSASAAVNLEATELSPEHback to top mRNA from alignment at H-paniculata_contig11883:5020..6692+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11883.1205.1 ID=mRNA_H-paniculata_contig11883.1205.1|Name=mRNA_H-paniculata_contig11883.1205.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=1673bp|location=Sequence derived from alignment at H-paniculata_contig11883:5020..6692+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11883:5020..6692+ >mRNA_H-paniculata_contig11883.1205.1 ID=mRNA_H-paniculata_contig11883.1205.1|Name=mRNA_H-paniculata_contig11883.1205.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=654bp|location=Sequence derived from alignment at H-paniculata_contig11883:5020..6692+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |