prot_H-paniculata_contig1163.1055.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1163.1055.1 vs. uniprot
Match: D8LFX5_ECTSI (EsV-1-7 (Partial) (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LFX5_ECTSI) HSP 1 Score: 68.9 bits (167), Expect = 1.540e-8 Identity = 27/57 (47.37%), Postives = 39/57 (68.42%), Query Frame = 0 Query: 599 CTADGCQQRPLFGIEGTKQAIFCSQHKAPGMTNVLCRRCEVESCKHQPSFAVEGSRA 655 C + C +R +G++GTK+A FC+QH+ GM NVL RCE E CK +P+F + G +A Sbjct: 5 CDHEFCPKRAHYGVDGTKRAQFCAQHRLGGMVNVLAPRCETEGCKKRPTFGIPGCKA 61
BLAST of mRNA_H-paniculata_contig1163.1055.1 vs. uniprot
Match: A0A6H5JGG2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGG2_9PHAE) HSP 1 Score: 57.4 bits (137), Expect = 5.800e-5 Identity = 24/44 (54.55%), Postives = 29/44 (65.91%), Query Frame = 0 Query: 594 RSRPTCTADGCQQRPLFGIEGTKQAIFCSQHKAPGMTNVLCRRC 637 R R C DGC RP +G G K+A FCSQHK PGM N++ +RC Sbjct: 22 RQRLCCQEDGCTTRPSYGNAGCKKAEFCSQHKKPGMMNLVSKRC 65 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1163.1055.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig1163.1055.1 ID=prot_H-paniculata_contig1163.1055.1|Name=mRNA_H-paniculata_contig1163.1055.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=785bpback to top |