prot_H-paniculata_contig11563.1000.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11563.1000.1 vs. uniprot
Match: A0A834XC68_9FABA (Retrovirus-related Pol polyprotein from transposon TNT 1-94 n=1 Tax=Senna tora TaxID=362788 RepID=A0A834XC68_9FABA) HSP 1 Score: 55.8 bits (133), Expect = 2.730e-7 Identity = 28/74 (37.84%), Postives = 39/74 (52.70%), Query Frame = 0 Query: 3 WNSDTGAIDHMTSDETAFEDYTPAFPWIMCEIANGNFVLMAGWGRLVLLVTAKLGRVAHVPELGCNLISTRRAT 76 W D+GA DHMTS+++ F P + +IA G + G G + + T L V HVP L CNL+S + T Sbjct: 95 WIVDSGASDHMTSNDSLFSTLAPCKTSLQVKIAYGTMAKVLGIGSVKISDTITLLNVLHVPTLACNLLSISKLT 168 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11563.1000.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11563.1000.1 ID=prot_H-paniculata_contig11563.1000.1|Name=mRNA_H-paniculata_contig11563.1000.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=76bpback to top |