prot_H-paniculata_contig11210.771.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11210.771.1 vs. uniprot
Match: D7FWR6_ECTSI (Putative 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FWR6_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 5.560e-6 Identity = 38/66 (57.58%), Postives = 43/66 (65.15%), Query Frame = 0 Query: 513 DMFLPSRRPLREMGECDD---WGAEGEEEFMSMLNLAMDEQQDAEARRTGAASMASLEGLGWDDED 575 + L S RPL E GE DD WGA+GEEEFMSMLNLAM E+QDAE RT + +E L D ED Sbjct: 756 EQSLLSPRPLDEFGEGDDGYDWGADGEEEFMSMLNLAM-EEQDAELSRTKGGAAMDMELLDMDMED 820 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11210.771.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11210.771.1 ID=prot_H-paniculata_contig11210.771.1|Name=mRNA_H-paniculata_contig11210.771.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=584bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|