mRNA_H-paniculata_contig11172.753.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11172.753.1 vs. uniprot
Match: A0A8B8ZHM9_PHODC (probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC n=1 Tax=Phoenix dactylifera TaxID=42345 RepID=A0A8B8ZHM9_PHODC) HSP 1 Score: 50.1 bits (118), Expect = 3.150e-5 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 1 Query: 7 DAVRCYQTAINLRPDFAIAYGNLASCYYDSGCLDQA 114 +A+ CYQ A+ + PD+A+AY NLAS YY+ G LD A Sbjct: 6 EAIMCYQRAVQVHPDYAMAYANLASTYYEQGQLDLA 41
BLAST of mRNA_H-paniculata_contig11172.753.1 vs. uniprot
Match: A0A453BT27_AEGTS (Uncharacterized protein n=3 Tax=Aegilops tauschii subsp. strangulata TaxID=200361 RepID=A0A453BT27_AEGTS) HSP 1 Score: 48.9 bits (115), Expect = 7.740e-5 Identity = 20/36 (55.56%), Postives = 27/36 (75.00%), Query Frame = 1 Query: 1 IPDAVRCYQTAINLRPDFAIAYGNLASCYYDSGCLD 108 + +AV CYQ A+ RPD+A+AYGNLA+ YY+ LD Sbjct: 16 LQEAVSCYQRALQARPDYAMAYGNLATIYYEQRQLD 51 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11172.753.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11172.753.1 >prot_H-paniculata_contig11172.753.1 ID=prot_H-paniculata_contig11172.753.1|Name=mRNA_H-paniculata_contig11172.753.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=77bp IPDAVRCYQTAINLRPDFAIAYGNLASCYYDSGCLDQAIRTFRYAIQLEPback to top mRNA from alignment at H-paniculata_contig11172:2291..3367+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11172.753.1 ID=mRNA_H-paniculata_contig11172.753.1|Name=mRNA_H-paniculata_contig11172.753.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=1077bp|location=Sequence derived from alignment at H-paniculata_contig11172:2291..3367+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11172:2291..3367+ >mRNA_H-paniculata_contig11172.753.1 ID=mRNA_H-paniculata_contig11172.753.1|Name=mRNA_H-paniculata_contig11172.753.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=462bp|location=Sequence derived from alignment at H-paniculata_contig11172:2291..3367+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |