prot_H-paniculata_contig108.513.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig108.513.1 vs. uniprot
Match: A0A6H5LAN5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LAN5_9PHAE) HSP 1 Score: 69.7 bits (169), Expect = 3.840e-12 Identity = 35/68 (51.47%), Postives = 40/68 (58.82%), Query Frame = 0 Query: 9 GFSERFEDERCAGGDLVDTWATRPTTAEQRPYRTGVGAGAVFDVGGQWLAAEREKNAERDDLRQREPW 76 G R+ G DLVDTW RPT+AE PY TG G+GAVFD GG+WLAAE+ R EPW Sbjct: 370 GVDNRYLATAGEGVDLVDTWGMRPTSAEHHPYGTGKGSGAVFDAGGEWLAAEKRGEMRRPV----EPW 433
BLAST of mRNA_H-paniculata_contig108.513.1 vs. uniprot
Match: D7FVH9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVH9_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 3.840e-12 Identity = 34/68 (50.00%), Postives = 40/68 (58.82%), Query Frame = 0 Query: 9 GFSERFEDERCAGGDLVDTWATRPTTAEQRPYRTGVGAGAVFDVGGQWLAAEREKNAERDDLRQREPW 76 G +R+ G DLVDTW RP +AE PY TG G+GAVFD GG+WLAAE+ R EPW Sbjct: 421 GVDDRYLATAGEGADLVDTWGMRPASAEHHPYGTGKGSGAVFDAGGEWLAAEKRGEMRRPV----EPW 484 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig108.513.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig108.513.1 ID=prot_H-paniculata_contig108.513.1|Name=mRNA_H-paniculata_contig108.513.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=77bpback to top |