prot_H-paniculata_contig963.17326.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JTC6_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JTC6_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 1.200e-12 Identity = 36/83 (43.37%), Postives = 53/83 (63.86%), Query Frame = 0 Query: 3 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVE-QVKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 84 G+ +DKS++R+ V +RED Y + + DG Q+KG +L+VD G H+W L+ P+K + +LA+SKRLESVRKD Sbjct: 40 GSTNDKSIIRYDTAVTKIREDPIYSEKEFTVYEADGTPYQLKGCYLLVDNGYHKWVTLIPPSKYPIDQNDLAFSKRLESVRKD 122
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JAU4_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAU4_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 3.550e-12 Identity = 36/83 (43.37%), Postives = 53/83 (63.86%), Query Frame = 0 Query: 3 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVE-QVKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 84 G+ +DKS++R+ V +RED Y + + DG Q+KG +L+VD G H+W L+ P+K + +LA+SKRLESVRKD Sbjct: 281 GSTNDKSIIRYDTAVTKIREDPIYSEKEFTVYEADGTPYQLKGCYLLVDNGYHKWVTLIPPSKYPIDQNDLAFSKRLESVRKD 363
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5K796_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K796_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 1.250e-9 Identity = 33/83 (39.76%), Postives = 49/83 (59.04%), Query Frame = 0 Query: 3 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQVK-GVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 84 GA +DK+++R+ V +R Y KLR +G ++++ G LIVD G H W L+ P+K E+ A+S+ LESVRKD Sbjct: 159 GATNDKTIIRYDSGVNKIRTASQYTEREYKLRKANGTKRMRRGCFLIVDNGYHEWVTLIAPSKYPQRNEDTAFSRDLESVRKD 241
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JQM6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQM6_9PHAE) HSP 1 Score: 60.5 bits (145), Expect = 5.490e-9 Identity = 31/83 (37.35%), Postives = 49/83 (59.04%), Query Frame = 0 Query: 3 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQVK-GVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 84 GA +DK+++R+ V +R + Y KLR +G E+ + G LI+D H W L+ P+K + ++ A+S+ LESVRKD Sbjct: 40 GATNDKTIIRYDSGVNNIRTESQYTEREYKLRKVNGTERTRRGCFLIMDNWYHEWVTLIAPSKYPQSNKDTAFSRHLESVRKD 122
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: D7FSK2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSK2_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 1.280e-8 Identity = 30/83 (36.14%), Postives = 52/83 (62.65%), Query Frame = 0 Query: 3 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQ-VKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 84 G+ +DK+ + + V+ +R D+ Y + ++DG +KG +++VD G H+W+ L+ P+K + +L +SKRLESVRKD Sbjct: 83 GSTNDKTTVCWDAAVEKIRTDKQYTEKTFDVYNQDGTTTTLKGCYVLVDNGYHKWQILIEPSKYPLSENDLLFSKRLESVRKD 165
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JUX7_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUX7_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.740e-8 Identity = 30/83 (36.14%), Postives = 51/83 (61.45%), Query Frame = 0 Query: 3 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQ-VKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 84 G+ +DK+++ + V +R D+ Y L ++DG +KG + + D G H+W+ L+ P+K + ++L +SKRLESVRKD Sbjct: 128 GSTNDKTIVCWDAAVDKIRTDKQYTEKTFDLYNEDGTTTTLKGCYFLDDNGYHKWQILIEPSKYPLSEDDLLFSKRLESVRKD 210
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JHI0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHI0_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 1.940e-7 Identity = 29/82 (35.37%), Postives = 49/82 (59.76%), Query Frame = 0 Query: 4 AVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQ-VKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 84 + +DK+ + + V+ +R D Y + ++DG +KG +L+VD G H+W+ L+ P K + ++ +SKRLESVRKD Sbjct: 224 STNDKTTVCWDAVVEKIRTDNQYTEKTFDVYNEDGTTTTLKGCYLLVDNGYHKWKILMEPTKYPLSENDILFSKRLESVRKD 305
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5L0X4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0X4_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 8.390e-6 Identity = 26/69 (37.68%), Postives = 44/69 (63.77%), Query Frame = 0 Query: 17 VQAVREDEPYRSMACKLRDKDGVEQ-VKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 84 V+ +R D+ Y + ++DG +KG +L+VD G H+W+ L+ P+K + +L +SKRL+SVR+D Sbjct: 273 VEKIRTDKQYTEKTFDVYNEDGTTTTLKGWYLLVDNGYHKWQILIEPSKYPLSENDLLFSKRLDSVRRD 341 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 8 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig963.17326.1 ID=prot_H-paniculata_contig963.17326.1|Name=mRNA_H-paniculata_contig963.17326.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=84bpback to top |