mRNA_H-paniculata_contig963.17326.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JTC6_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JTC6_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 1.200e-12 Identity = 36/83 (43.37%), Postives = 53/83 (63.86%), Query Frame = 3 Query: 9 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVE-QVKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 254 G+ +DKS++R+ V +RED Y + + DG Q+KG +L+VD G H+W L+ P+K + +LA+SKRLESVRKD Sbjct: 40 GSTNDKSIIRYDTAVTKIREDPIYSEKEFTVYEADGTPYQLKGCYLLVDNGYHKWVTLIPPSKYPIDQNDLAFSKRLESVRKD 122
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JAU4_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAU4_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 3.550e-12 Identity = 36/83 (43.37%), Postives = 53/83 (63.86%), Query Frame = 3 Query: 9 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVE-QVKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 254 G+ +DKS++R+ V +RED Y + + DG Q+KG +L+VD G H+W L+ P+K + +LA+SKRLESVRKD Sbjct: 281 GSTNDKSIIRYDTAVTKIREDPIYSEKEFTVYEADGTPYQLKGCYLLVDNGYHKWVTLIPPSKYPIDQNDLAFSKRLESVRKD 363
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5K796_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K796_9PHAE) HSP 1 Score: 62.8 bits (151), Expect = 1.250e-9 Identity = 33/83 (39.76%), Postives = 49/83 (59.04%), Query Frame = 3 Query: 9 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQVK-GVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 254 GA +DK+++R+ V +R Y KLR +G ++++ G LIVD G H W L+ P+K E+ A+S+ LESVRKD Sbjct: 159 GATNDKTIIRYDSGVNKIRTASQYTEREYKLRKANGTKRMRRGCFLIVDNGYHEWVTLIAPSKYPQRNEDTAFSRDLESVRKD 241
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JQM6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQM6_9PHAE) HSP 1 Score: 60.5 bits (145), Expect = 5.490e-9 Identity = 31/83 (37.35%), Postives = 49/83 (59.04%), Query Frame = 3 Query: 9 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQVK-GVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 254 GA +DK+++R+ V +R + Y KLR +G E+ + G LI+D H W L+ P+K + ++ A+S+ LESVRKD Sbjct: 40 GATNDKTIIRYDSGVNNIRTESQYTEREYKLRKVNGTERTRRGCFLIMDNWYHEWVTLIAPSKYPQSNKDTAFSRHLESVRKD 122
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: D7FSK2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSK2_ECTSI) HSP 1 Score: 59.7 bits (143), Expect = 1.280e-8 Identity = 30/83 (36.14%), Postives = 52/83 (62.65%), Query Frame = 3 Query: 9 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQ-VKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 254 G+ +DK+ + + V+ +R D+ Y + ++DG +KG +++VD G H+W+ L+ P+K + +L +SKRLESVRKD Sbjct: 83 GSTNDKTTVCWDAAVEKIRTDKQYTEKTFDVYNQDGTTTTLKGCYVLVDNGYHKWQILIEPSKYPLSENDLLFSKRLESVRKD 165
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JUX7_9PHAE (DDE Tnp4 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUX7_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 2.740e-8 Identity = 30/83 (36.14%), Postives = 51/83 (61.45%), Query Frame = 3 Query: 9 GAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQ-VKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 254 G+ +DK+++ + V +R D+ Y L ++DG +KG + + D G H+W+ L+ P+K + ++L +SKRLESVRKD Sbjct: 128 GSTNDKTIVCWDAAVDKIRTDKQYTEKTFDLYNEDGTTTTLKGCYFLDDNGYHKWQILIEPSKYPLSEDDLLFSKRLESVRKD 210
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5JHI0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHI0_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 1.940e-7 Identity = 29/82 (35.37%), Postives = 49/82 (59.76%), Query Frame = 3 Query: 12 AVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQ-VKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 254 + +DK+ + + V+ +R D Y + ++DG +KG +L+VD G H+W+ L+ P K + ++ +SKRLESVRKD Sbjct: 224 STNDKTTVCWDAVVEKIRTDNQYTEKTFDVYNEDGTTTTLKGCYLLVDNGYHKWKILMEPTKYPLSENDILFSKRLESVRKD 305
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Match: A0A6H5L0X4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0X4_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 8.390e-6 Identity = 26/69 (37.68%), Postives = 44/69 (63.77%), Query Frame = 3 Query: 51 VQAVREDEPYRSMACKLRDKDGVEQ-VKGVHLIVDGGCHRWRNLVCPAKEAATREELAWSKRLESVRKD 254 V+ +R D+ Y + ++DG +KG +L+VD G H+W+ L+ P+K + +L +SKRL+SVR+D Sbjct: 273 VEKIRTDKQYTEKTFDVYNEDGTTTTLKGWYLLVDNGYHKWQILIEPSKYPLSENDLLFSKRLDSVRRD 341 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig963.17326.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 8 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig963.17326.1 >prot_H-paniculata_contig963.17326.1 ID=prot_H-paniculata_contig963.17326.1|Name=mRNA_H-paniculata_contig963.17326.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=84bp MAGAVSDKSVLRFRKTVQAVREDEPYRSMACKLRDKDGVEQVKGVHLIVDback to top mRNA from alignment at H-paniculata_contig963:2046..2898- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig963.17326.1 ID=mRNA_H-paniculata_contig963.17326.1|Name=mRNA_H-paniculata_contig963.17326.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=853bp|location=Sequence derived from alignment at H-paniculata_contig963:2046..2898- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig963:2046..2898- >mRNA_H-paniculata_contig963.17326.1 ID=mRNA_H-paniculata_contig963.17326.1|Name=mRNA_H-paniculata_contig963.17326.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=504bp|location=Sequence derived from alignment at H-paniculata_contig963:2046..2898- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |