Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig9542.17265.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..10 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 11..22 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 23..27 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 28..111 |
None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..27 |
None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..27 score: 0.88 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig9542.17265.1 ID=prot_H-paniculata_contig9542.17265.1|Name=mRNA_H-paniculata_contig9542.17265.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=112bp MRFARLGCVNLALLSFLLLGVFTRTHGEGDGDGQEDNAGNENPVSRQETP QADVNVIDEATATYFYVKDEGKPRDKLPRRCFVLTQPGGTQFHVHYHFEA AKVAGNEARTE* back to top
|