prot_H-paniculata_contig95.17236.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KKV8_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKV8_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 2.340e-14 Identity = 42/71 (59.15%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 5 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AKRAEDAG+AV+VYMDESFVH Sbjct: 85 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKRAEDAGVAVIVYMDESFVH 155
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KDX2_9PHAE (Uncharacterized protein n=8 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDX2_9PHAE) HSP 1 Score: 74.7 bits (182), Expect = 2.710e-14 Identity = 42/71 (59.15%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 5 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AKRAEDAG+AV+VYMDESFVH Sbjct: 206 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKRAEDAGIAVIVYMDESFVH 276
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KF48_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KF48_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.700e-14 Identity = 42/71 (59.15%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 5 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AKRAEDAG+AV+VYMDESFVH Sbjct: 85 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKRAEDAGVAVIVYMDESFVH 155
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KCN2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCN2_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 1.280e-13 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 5 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AKRAEDAG+AV+VY+DESFVH Sbjct: 85 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKRAEDAGVAVIVYIDESFVH 155
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KP14_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KP14_9PHAE) HSP 1 Score: 71.6 bits (174), Expect = 3.270e-13 Identity = 41/71 (57.75%), Postives = 47/71 (66.20%), Query Frame = 0 Query: 5 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AK AEDAG+AV+VYMDESFVH Sbjct: 129 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKGAEDAGVAVIVYMDESFVH 199
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5K8G5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8G5_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 6.800e-12 Identity = 39/71 (54.93%), Postives = 46/71 (64.79%), Query Frame = 0 Query: 5 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 C+ E+SNRAVGGLLQRL RIRLFLV+M +AKR EDAG+AV+VY+DESFVH Sbjct: 206 CSCGLEMSNRAVGGLLQRLGFERCRGRIKIPPLNEERKNRIRLFLVKMLLAKRPEDAGVAVIVYIDESFVH 276
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5K658_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K658_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 7.960e-12 Identity = 37/65 (56.92%), Postives = 43/65 (66.15%), Query Frame = 0 Query: 11 VSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 +SNRAVGG+LQRL RI FLV+MD+AKRAEDAG+AV+VYMDESFVH Sbjct: 1 MSNRAVGGMLQRLGSKRRRGRINIPPLIEERKNRIPFFLVKMDLAKRAEDAGIAVIVYMDESFVH 65
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5JWX3_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWX3_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 1.450e-11 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 21 QRLARIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 +RLARIR FLVEMD+AKRAEDAGLAV+VYMDESFVH Sbjct: 105 ERLARIRRFLVEMDMAKRAEDAGLAVIVYMDESFVH 140
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KF49_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KF49_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 1.900e-11 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 22 RLARIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 RLARIR FLVEMDIAKRAEDAGLAV+VYMDESFVH Sbjct: 248 RLARIRRFLVEMDIAKRAEDAGLAVIVYMDESFVH 282
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KAU4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAU4_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 2.580e-11 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 0 Query: 21 QRLARIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 56 +RLARIR FLVEMD+AKRAEDAGLAV+VYMDESFVH Sbjct: 215 ERLARIRRFLVEMDMAKRAEDAGLAVIVYMDESFVH 250 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig95.17236.1 ID=prot_H-paniculata_contig95.17236.1|Name=mRNA_H-paniculata_contig95.17236.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=56bpback to top |