mRNA_H-paniculata_contig95.17236.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KKV8_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKV8_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 2.340e-14 Identity = 42/71 (59.15%), Postives = 48/71 (67.61%), Query Frame = 1 Query: 13 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AKRAEDAG+AV+VYMDESFVH Sbjct: 85 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKRAEDAGVAVIVYMDESFVH 155
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KDX2_9PHAE (Uncharacterized protein n=8 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDX2_9PHAE) HSP 1 Score: 74.7 bits (182), Expect = 2.710e-14 Identity = 42/71 (59.15%), Postives = 48/71 (67.61%), Query Frame = 1 Query: 13 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AKRAEDAG+AV+VYMDESFVH Sbjct: 206 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKRAEDAGIAVIVYMDESFVH 276
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KF48_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KF48_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.700e-14 Identity = 42/71 (59.15%), Postives = 48/71 (67.61%), Query Frame = 1 Query: 13 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AKRAEDAG+AV+VYMDESFVH Sbjct: 85 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKRAEDAGVAVIVYMDESFVH 155
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KCN2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCN2_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 1.280e-13 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 1 Query: 13 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AKRAEDAG+AV+VY+DESFVH Sbjct: 85 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKRAEDAGVAVIVYIDESFVH 155
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KP14_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KP14_9PHAE) HSP 1 Score: 71.6 bits (174), Expect = 3.270e-13 Identity = 41/71 (57.75%), Postives = 47/71 (66.20%), Query Frame = 1 Query: 13 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 C+ E+SNRAVGGLLQRL RIRLFLV+MD+AK AEDAG+AV+VYMDESFVH Sbjct: 129 CSFGLEMSNRAVGGLLQRLGFKRRRGRIKIPPLNEERKNRIRLFLVKMDLAKGAEDAGVAVIVYMDESFVH 199
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5K8G5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8G5_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 6.800e-12 Identity = 39/71 (54.93%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 13 CNPDKEVSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 C+ E+SNRAVGGLLQRL RIRLFLV+M +AKR EDAG+AV+VY+DESFVH Sbjct: 206 CSCGLEMSNRAVGGLLQRLGFERCRGRIKIPPLNEERKNRIRLFLVKMLLAKRPEDAGVAVIVYIDESFVH 276
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5K658_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K658_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 7.960e-12 Identity = 37/65 (56.92%), Postives = 43/65 (66.15%), Query Frame = 1 Query: 31 VSNRAVGGLLQRLA-------------------RIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 +SNRAVGG+LQRL RI FLV+MD+AKRAEDAG+AV+VYMDESFVH Sbjct: 1 MSNRAVGGMLQRLGSKRRRGRINIPPLIEERKNRIPFFLVKMDLAKRAEDAGIAVIVYMDESFVH 65
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5JWX3_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWX3_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 1.450e-11 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 61 QRLARIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 +RLARIR FLVEMD+AKRAEDAGLAV+VYMDESFVH Sbjct: 105 ERLARIRRFLVEMDMAKRAEDAGLAVIVYMDESFVH 140
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KF49_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KF49_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 1.900e-11 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 64 RLARIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 RLARIR FLVEMDIAKRAEDAGLAV+VYMDESFVH Sbjct: 248 RLARIRRFLVEMDIAKRAEDAGLAVIVYMDESFVH 282
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Match: A0A6H5KAU4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAU4_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 2.580e-11 Identity = 32/36 (88.89%), Postives = 35/36 (97.22%), Query Frame = 1 Query: 61 QRLARIRLFLVEMDIAKRAEDAGLAVLVYMDESFVH 168 +RLARIR FLVEMD+AKRAEDAGLAV+VYMDESFVH Sbjct: 215 ERLARIRRFLVEMDMAKRAEDAGLAVIVYMDESFVH 250 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig95.17236.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig95.17236.1 >prot_H-paniculata_contig95.17236.1 ID=prot_H-paniculata_contig95.17236.1|Name=mRNA_H-paniculata_contig95.17236.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=56bp MIEHCNPDKEVSNRAVGGLLQRLARIRLFLVEMDIAKRAEDAGLAVLVYMback to top mRNA from alignment at H-paniculata_contig95:32971..33179- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig95.17236.1 ID=mRNA_H-paniculata_contig95.17236.1|Name=mRNA_H-paniculata_contig95.17236.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=209bp|location=Sequence derived from alignment at H-paniculata_contig95:32971..33179- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig95:32971..33179- >mRNA_H-paniculata_contig95.17236.1 ID=mRNA_H-paniculata_contig95.17236.1|Name=mRNA_H-paniculata_contig95.17236.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=336bp|location=Sequence derived from alignment at H-paniculata_contig95:32971..33179- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |