Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig9182.16989.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 47..131 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 1..20 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 21..46 |
None | No IPR available | TMHMM | TMhelix | | coord: 20..42 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig9182.16989.1 ID=prot_H-paniculata_contig9182.16989.1|Name=mRNA_H-paniculata_contig9182.16989.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=131bp MRQRPRSSSTTSRFSSRVTIQLLLEAVGLLSCVPFCTSFMAMSAFVPTML LSGSTRSLTTQLRWHHASSSPTTTASWIATAAAPALLAQRRWTTATMAMT MGGSSSGNIREGDRLFSSPAETPAGCSAAPG back to top
|