|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR002110 | Ankyrin repeat | PRINTS | PR01415 | ANKYRIN | coord: 316..330
score: 41.51
coord: 202..217
score: 36.72 |
| IPR002110 | Ankyrin repeat | SMART | SM00248 | ANK_2a | coord: 201..230
e-value: 0.0022
score: 27.2
coord: 234..263
e-value: 1.8E-4
score: 30.9
coord: 267..296
e-value: 0.095
score: 21.8
coord: 98..127
e-value: 490.0
score: 7.3
coord: 168..197
e-value: 0.24
score: 20.5
coord: 131..164
e-value: 420.0
score: 7.8
coord: 31..60
e-value: 8.9E-4
score: 28.6
coord: 300..329
e-value: 3.3E-4
score: 30.0
coord: 65..94
e-value: 0.038
score: 23.2 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 267..294
score: 10.472 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 201..233
score: 11.808 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 31..63
score: 11.594 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 300..332
score: 13.517 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 65..97
score: 10.446 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 168..200
score: 10.339 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 234..266
score: 11.888 |
| IPR036770 | Ankyrin repeat-containing domain superfamily | GENE3D | 1.25.40.20 | | coord: 183..257
e-value: 1.5E-22
score: 82.0 |
| IPR036770 | Ankyrin repeat-containing domain superfamily | GENE3D | 1.25.40.20 | | coord: 258..354
e-value: 4.7E-25
score: 90.0 |
| IPR036770 | Ankyrin repeat-containing domain superfamily | GENE3D | 1.25.40.20 | | coord: 1..107
e-value: 7.4E-22
score: 79.3 |
| IPR036770 | Ankyrin repeat-containing domain superfamily | GENE3D | 1.25.40.20 | | coord: 108..182
e-value: 7.7E-10
score: 40.5 |
| IPR036770 | Ankyrin repeat-containing domain superfamily | SUPERFAMILY | 48403 | Ankyrin repeat | coord: 1..353 |
| IPR020683 | Ankyrin repeat-containing domain | PFAM | PF12796 | Ank_2 | coord: 267..329
e-value: 3.7E-11
score: 43.5
coord: 104..197
e-value: 4.9E-8
score: 33.5
coord: 201..263
e-value: 3.6E-13
score: 49.9
coord: 1..95
e-value: 5.1E-9
score: 36.6 |
| IPR020683 | Ankyrin repeat-containing domain | PROSITE | PS50297 | ANK_REP_REGION | coord: 1..354
score: 90.729 |
| None | No IPR available | PANTHER | PTHR24166 | FAMILY NOT NAMED | coord: 68..232
coord: 2..193
coord: 146..353 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig31876.8585.1 ID=prot_H-paniculata_contig31876.8585.1|Name=mRNA_H-paniculata_contig31876.8585.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=354bp
MHRAAYMGDVHRVMTCLQENPGINLDALSADGSSALYIACTNGHSSVASV
LIRAGADANLRCGPTELTPLHASVSGGHIGMLRQLVEAGGDLSIRASRGL
AVAHLAVLADSQEGLHEVVKLGADLDVQDHCGMTALMICAGYPNTENASG
KAQILLNGGAHLDLVDAKGETALLFAVNSENYGVLQVLLDAGASLTDRSS
AGETAVMTAAANGYLEVVRLLCDAGADLSDRNSMDYTPLMMAATNGHSKV
VQLLRDAGADISDHDGAGVTALVVAAYEGKLEMVQYLIEAGASIMPVIAT
GASPLQAAAVNGHTEIVQELISAGADVNHSSREFNVGMTAMHLAAGESHV
DTVR back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|