prot_H-paniculata_contig14048.2474.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14048.2474.1 vs. uniprot
Match: A0A6H5JWM1_9PHAE (RING-CH-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWM1_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 6.280e-7 Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = 0 Query: 5 SVVHAVSKYLDPHVLASLGSRSE-YVALRNILQ 36 SV HAVSKYLDPHVLASLG RSE Y ALR++LQ Sbjct: 736 SVTHAVSKYLDPHVLASLGGRSELYPALRDVLQ 768
BLAST of mRNA_H-paniculata_contig14048.2474.1 vs. uniprot
Match: D8LBR1_ECTSI (RING-CH-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBR1_ECTSI) HSP 1 Score: 51.6 bits (122), Expect = 1.610e-6 Identity = 25/33 (75.76%), Postives = 30/33 (90.91%), Query Frame = 0 Query: 5 SVVHAVSKYLDPHVLASLGSRSE-YVALRNILQ 36 SV HAVSKYLDPHVL+SLG RSE Y+ALR+++Q Sbjct: 652 SVTHAVSKYLDPHVLSSLGGRSELYLALRDVVQ 684 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14048.2474.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14048.2474.1 ID=prot_H-paniculata_contig14048.2474.1|Name=mRNA_H-paniculata_contig14048.2474.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=37bpback to top |