mRNA_H-paniculata_contig14048.2474.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14048.2474.1 vs. uniprot
Match: A0A6H5JWM1_9PHAE (RING-CH-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWM1_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 6.280e-7 Identity = 27/33 (81.82%), Postives = 29/33 (87.88%), Query Frame = 1 Query: 13 SVVHAVSKYLDPHVLASLGSRSE-YVALRNILQ 108 SV HAVSKYLDPHVLASLG RSE Y ALR++LQ Sbjct: 736 SVTHAVSKYLDPHVLASLGGRSELYPALRDVLQ 768
BLAST of mRNA_H-paniculata_contig14048.2474.1 vs. uniprot
Match: D8LBR1_ECTSI (RING-CH-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBR1_ECTSI) HSP 1 Score: 51.6 bits (122), Expect = 1.610e-6 Identity = 25/33 (75.76%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 13 SVVHAVSKYLDPHVLASLGSRSE-YVALRNILQ 108 SV HAVSKYLDPHVL+SLG RSE Y+ALR+++Q Sbjct: 652 SVTHAVSKYLDPHVLSSLGGRSELYLALRDVVQ 684 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14048.2474.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14048.2474.1 >prot_H-paniculata_contig14048.2474.1 ID=prot_H-paniculata_contig14048.2474.1|Name=mRNA_H-paniculata_contig14048.2474.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=37bp MPTGSVVHAVSKYLDPHVLASLGSRSEYVALRNILQAback to top mRNA from alignment at H-paniculata_contig14048:5410..5520- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14048.2474.1 ID=mRNA_H-paniculata_contig14048.2474.1|Name=mRNA_H-paniculata_contig14048.2474.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=111bp|location=Sequence derived from alignment at H-paniculata_contig14048:5410..5520- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14048:5410..5520- >mRNA_H-paniculata_contig14048.2474.1 ID=mRNA_H-paniculata_contig14048.2474.1|Name=mRNA_H-paniculata_contig14048.2474.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=222bp|location=Sequence derived from alignment at H-paniculata_contig14048:5410..5520- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |