prot_H-paniculata_contig1232.1466.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1232.1466.1 vs. uniprot
Match: A0A6H5JAU4_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAU4_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 1.740e-7 Identity = 25/49 (51.02%), Postives = 35/49 (71.43%), Query Frame = 0 Query: 2 FFLGLVSLAEEKRWFRSAACYVARRAGIPVELKVLAVLQVLGRGHCFDD 50 FF+ LV+L +++ WF + + R GIPV+LKVLA LQ+L RG+CF D Sbjct: 126 FFVELVALVKQRDWFPTGKQDASGRRGIPVQLKVLACLQILARGNCFAD 174
BLAST of mRNA_H-paniculata_contig1232.1466.1 vs. uniprot
Match: A0A6H5JPH7_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPH7_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 5.450e-6 Identity = 24/49 (48.98%), Postives = 31/49 (63.27%), Query Frame = 0 Query: 2 FFLGLVSLAEEKRWFRSAACYVARRAGIPVELKVLAVLQVLGRGHCFDD 50 FF+ LV L ++ WF + V R +PVELKVLA LQ+L RG+ F D Sbjct: 142 FFVHLVELVRDRDWFPTGESDVTGRQAVPVELKVLACLQILSRGNVFAD 190 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1232.1466.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig1232.1466.1 ID=prot_H-paniculata_contig1232.1466.1|Name=mRNA_H-paniculata_contig1232.1466.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=50bpback to top |