mRNA_H-paniculata_contig1232.1466.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig1232.1466.1 vs. uniprot
Match: A0A6H5JAU4_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAU4_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 1.740e-7 Identity = 25/49 (51.02%), Postives = 35/49 (71.43%), Query Frame = 1 Query: 4 FFLGLVSLAEEKRWFRSAACYVARRAGIPVELKVLAVLQVLGRGHCFDD 150 FF+ LV+L +++ WF + + R GIPV+LKVLA LQ+L RG+CF D Sbjct: 126 FFVELVALVKQRDWFPTGKQDASGRRGIPVQLKVLACLQILARGNCFAD 174
BLAST of mRNA_H-paniculata_contig1232.1466.1 vs. uniprot
Match: A0A6H5JPH7_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPH7_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 5.450e-6 Identity = 24/49 (48.98%), Postives = 31/49 (63.27%), Query Frame = 1 Query: 4 FFLGLVSLAEEKRWFRSAACYVARRAGIPVELKVLAVLQVLGRGHCFDD 150 FF+ LV L ++ WF + V R +PVELKVLA LQ+L RG+ F D Sbjct: 142 FFVHLVELVRDRDWFPTGESDVTGRQAVPVELKVLACLQILSRGNVFAD 190 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig1232.1466.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig1232.1466.1 >prot_H-paniculata_contig1232.1466.1 ID=prot_H-paniculata_contig1232.1466.1|Name=mRNA_H-paniculata_contig1232.1466.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=50bp MFFLGLVSLAEEKRWFRSAACYVARRAGIPVELKVLAVLQVLGRGHCFDDback to top mRNA from alignment at H-paniculata_contig1232:26987..27547- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig1232.1466.1 ID=mRNA_H-paniculata_contig1232.1466.1|Name=mRNA_H-paniculata_contig1232.1466.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=561bp|location=Sequence derived from alignment at H-paniculata_contig1232:26987..27547- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig1232:26987..27547- >mRNA_H-paniculata_contig1232.1466.1 ID=mRNA_H-paniculata_contig1232.1466.1|Name=mRNA_H-paniculata_contig1232.1466.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=300bp|location=Sequence derived from alignment at H-paniculata_contig1232:26987..27547- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |