prot_H-paniculata_contig12262.1442.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5JYX7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYX7_9PHAE) HSP 1 Score: 84.0 bits (206), Expect = 1.380e-17 Identity = 40/54 (74.07%), Postives = 45/54 (83.33%), Query Frame = 0 Query: 1 MDNSRLNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 + + L DGKPHVLVLDGHASHVT+DV+K A+ NIHL QLPSH SHITQPLDV Sbjct: 281 LGDRNLLDGKPHVLVLDGHASHVTLDVIKLAISLNIHLVQLPSHMSHITQPLDV 334
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5KMD7_9PHAE (DDE-1 domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KMD7_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 1.590e-17 Identity = 37/54 (68.52%), Postives = 43/54 (79.63%), Query Frame = 0 Query: 1 MDNSRLNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 + + L DGKPHVLVLDGH SHV++DV+K A+ NIHL QL SH SHITQPLDV Sbjct: 17 LGDRNLLDGKPHVLVLDGHTSHVSLDVIKLAISLNIHLVQLASHMSHITQPLDV 70
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5KP55_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KP55_9PHAE) HSP 1 Score: 82.0 bits (201), Expect = 1.990e-17 Identity = 39/49 (79.59%), Postives = 43/49 (87.76%), Query Frame = 0 Query: 6 LNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 L DGKPHVLVLDGHASHV++DV+K A+ NIHL QLPSH SHITQPLDV Sbjct: 137 LLDGKPHVLVLDGHASHVSLDVIKLAISLNIHLVQLPSHMSHITQPLDV 185
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5JR26_9PHAE (DDE-1 domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JR26_9PHAE) HSP 1 Score: 82.0 bits (201), Expect = 2.530e-17 Identity = 39/49 (79.59%), Postives = 43/49 (87.76%), Query Frame = 0 Query: 6 LNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 L DGKPHVLVLDGHASHV++DV+K A+ NIHL QLPSH SHITQPLDV Sbjct: 210 LLDGKPHVLVLDGHASHVSLDVIKLAISLNIHLVQLPSHMSHITQPLDV 258
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5JBS6_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JBS6_9PHAE) HSP 1 Score: 81.6 bits (200), Expect = 8.460e-17 Identity = 39/54 (72.22%), Postives = 46/54 (85.19%), Query Frame = 0 Query: 1 MDNSRLNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 +D+ + DGKPH LVLDGHASHV+ +V+K AME NI LFQLPSH+SHITQPLDV Sbjct: 261 LDDRGVLDGKPHTLVLDGHASHVSYEVIKLAMELNIILFQLPSHTSHITQPLDV 314
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5K306_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K306_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 1.030e-16 Identity = 37/54 (68.52%), Postives = 44/54 (81.48%), Query Frame = 0 Query: 1 MDNSRLNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 + + L DGKPHVLVLDGHASHV++DV+K A+ +IHL QLPSH SHITQPL V Sbjct: 73 LSDRNLLDGKPHVLVLDGHASHVSLDVIKLAISLDIHLVQLPSHMSHITQPLVV 126
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5KHG9_9PHAE (DDE-1 domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KHG9_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 1.350e-16 Identity = 36/54 (66.67%), Postives = 46/54 (85.19%), Query Frame = 0 Query: 1 MDNSRLNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 +D+ + DGKPH+LVLDGHA HV+ +V++ AME NI LFQ+PSH+SHITQPLDV Sbjct: 87 LDDRGVFDGKPHILVLDGHALHVSYEVIELAMELNIILFQMPSHTSHITQPLDV 140
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5L108_9PHAE (DDE-1 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L108_9PHAE) HSP 1 Score: 78.6 bits (192), Expect = 1.460e-16 Identity = 38/54 (70.37%), Postives = 45/54 (83.33%), Query Frame = 0 Query: 1 MDNSRLNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 +D + +GKPHVLV DGHASHV+ +V+K AME NI LFQLPSH+SHITQPLDV Sbjct: 148 LDGRGVLEGKPHVLVHDGHASHVSYEVIKLAMELNIILFQLPSHTSHITQPLDV 201
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5JV04_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV04_9PHAE) HSP 1 Score: 80.5 bits (197), Expect = 2.410e-16 Identity = 37/49 (75.51%), Postives = 45/49 (91.84%), Query Frame = 0 Query: 6 LNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 L DGKPH+L+LDGHASHV+++V++ AME NI LFQLPSH+SHITQPLDV Sbjct: 270 LIDGKPHILLLDGHASHVSVEVIQLAMELNIVLFQLPSHTSHITQPLDV 318
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Match: A0A6H5JJ12_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ12_9PHAE) HSP 1 Score: 80.5 bits (197), Expect = 2.410e-16 Identity = 37/49 (75.51%), Postives = 45/49 (91.84%), Query Frame = 0 Query: 6 LNDGKPHVLVLDGHASHVTIDVLKYAMEHNIHLFQLPSHSSHITQPLDV 54 L DGKPH+L+LDGHASHV+++V++ AME NI LFQLPSH+SHITQPLDV Sbjct: 511 LIDGKPHILLLDGHASHVSVEVIQLAMELNIVLFQLPSHTSHITQPLDV 559 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig12262.1442.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig12262.1442.1 ID=prot_H-paniculata_contig12262.1442.1|Name=mRNA_H-paniculata_contig12262.1442.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=55bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|