prot_H-paniculata_contig11469.953.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A835YZN4_9STRA (Deoxycytidylate deaminase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YZN4_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 1.290e-11 Identity = 38/49 (77.55%), Postives = 42/49 (85.71%), Query Frame = 0 Query: 207 AKVDP-SVPK---AVGGKREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 251 AK++P +VP AVGG R+DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 16 AKLEPQAVPAPTWAVGGARKDYLHWDDYFMSVAFLSAMRSKDPSTQVGA 64
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A6H5KYL3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYL3_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 2.960e-11 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 0 Query: 220 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGAW 252 KR DYLVWDDYFMSVAFLSAMRSKDPSTQVGAW Sbjct: 122 KRIDYLVWDDYFMSVAFLSAMRSKDPSTQVGAW 154
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: W4H6T0_9STRA (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=W4H6T0_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 1.160e-10 Identity = 30/33 (90.91%), Postives = 32/33 (96.97%), Query Frame = 0 Query: 220 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGAW 252 KR+DYL WDDYFMSVAFLS+MRSKDPSTQVGAW Sbjct: 35 KRKDYLSWDDYFMSVAFLSSMRSKDPSTQVGAW 67
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A7S2WUA8_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WUA8_9STRA) HSP 1 Score: 70.5 bits (171), Expect = 1.570e-10 Identity = 36/50 (72.00%), Postives = 38/50 (76.00%), Query Frame = 0 Query: 207 AKVDPSVPKAVGG-----KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 251 A+V P+ A GG KR DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 63 ARVQPAAGAAAGGSSAGTKRPDYLSWDDYFMSVAFLSAMRSKDPSTQVGA 112
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A6A3QXT7_9STRA (CMP/dCMP-type deaminase domain-containing protein n=3 Tax=Phytophthora TaxID=4783 RepID=A0A6A3QXT7_9STRA) HSP 1 Score: 70.5 bits (171), Expect = 1.680e-10 Identity = 33/38 (86.84%), Postives = 34/38 (89.47%), Query Frame = 0 Query: 214 PKAVGGKREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 251 PK+V KR DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 147 PKSVVEKRSDYLSWDDYFMSVAFLSAMRSKDPSTQVGA 184
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A225WBM0_9STRA (Deoxycytidylate deaminase n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225WBM0_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 2.010e-10 Identity = 32/41 (78.05%), Postives = 34/41 (82.93%), Query Frame = 0 Query: 211 PSVPKAVGGKREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 251 P+ P + KR DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 94 PTAPTSAVQKRSDYLSWDDYFMSVAFLSAMRSKDPSTQVGA 134
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: W4H5F2_9STRA (CMP/dCMP-type deaminase domain-containing protein n=3 Tax=Aphanomyces astaci TaxID=112090 RepID=W4H5F2_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 3.440e-10 Identity = 30/33 (90.91%), Postives = 32/33 (96.97%), Query Frame = 0 Query: 220 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGAW 252 KR+DYL WDDYFMSVAFLS+MRSKDPSTQVGAW Sbjct: 35 KRKDYLSWDDYFMSVAFLSSMRSKDPSTQVGAW 67
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A443RP84_9ACAR (Centrosomal protein of 44 kDa-like isoform X2 n=1 Tax=Dinothrombium tinctorium TaxID=1965070 RepID=A0A443RP84_9ACAR) HSP 1 Score: 67.0 bits (162), Expect = 4.810e-10 Identity = 29/33 (87.88%), Postives = 32/33 (96.97%), Query Frame = 0 Query: 219 GKREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 251 GKREDYL WD+YFMS+A+LSAMRSKDPSTQVGA Sbjct: 10 GKREDYLQWDEYFMSIAYLSAMRSKDPSTQVGA 42
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: H3G722_PHYRM (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3G722_PHYRM) HSP 1 Score: 65.9 bits (159), Expect = 1.050e-9 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 220 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 251 KR DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 2 KRSDYLSWDDYFMSVAFLSAMRSKDPSTQVGA 33
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: D8LJR7_ECTSI (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJR7_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 1.130e-9 Identity = 31/32 (96.88%), Postives = 31/32 (96.88%), Query Frame = 0 Query: 220 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 251 KR DYLVWDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 121 KRTDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 152 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11469.953.1 ID=prot_H-paniculata_contig11469.953.1|Name=mRNA_H-paniculata_contig11469.953.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=253bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|