mRNA_H-paniculata_contig11469.953.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A835YZN4_9STRA (Deoxycytidylate deaminase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YZN4_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 3.960e-11 Identity = 38/49 (77.55%), Postives = 42/49 (85.71%), Query Frame = 1 Query: 676 AKVDP-SVPK---AVGGKREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 810 AK++P +VP AVGG R+DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 16 AKLEPQAVPAPTWAVGGARKDYLHWDDYFMSVAFLSAMRSKDPSTQVGA 64
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A6H5KYL3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYL3_9PHAE) HSP 1 Score: 71.2 bits (173), Expect = 8.910e-11 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 715 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGAW 813 KR DYLVWDDYFMSVAFLSAMRSKDPSTQVGAW Sbjct: 122 KRIDYLVWDDYFMSVAFLSAMRSKDPSTQVGAW 154
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: W4H6T0_9STRA (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=W4H6T0_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 3.280e-10 Identity = 30/33 (90.91%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 715 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGAW 813 KR+DYL WDDYFMSVAFLS+MRSKDPSTQVGAW Sbjct: 35 KRKDYLSWDDYFMSVAFLSSMRSKDPSTQVGAW 67
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A7S2WUA8_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WUA8_9STRA) HSP 1 Score: 70.5 bits (171), Expect = 4.880e-10 Identity = 36/50 (72.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 676 AKVDPSVPKAVGG-----KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 810 A+V P+ A GG KR DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 63 ARVQPAAGAAAGGSSAGTKRPDYLSWDDYFMSVAFLSAMRSKDPSTQVGA 112
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A6A3QXT7_9STRA (CMP/dCMP-type deaminase domain-containing protein n=3 Tax=Phytophthora TaxID=4783 RepID=A0A6A3QXT7_9STRA) HSP 1 Score: 70.5 bits (171), Expect = 5.260e-10 Identity = 33/38 (86.84%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 697 PKAVGGKREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 810 PK+V KR DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 147 PKSVVEKRSDYLSWDDYFMSVAFLSAMRSKDPSTQVGA 184
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A225WBM0_9STRA (Deoxycytidylate deaminase n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225WBM0_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 5.950e-10 Identity = 32/41 (78.05%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 688 PSVPKAVGGKREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 810 P+ P + KR DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 94 PTAPTSAVQKRSDYLSWDDYFMSVAFLSAMRSKDPSTQVGA 134
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: W4H5F2_9STRA (CMP/dCMP-type deaminase domain-containing protein n=3 Tax=Aphanomyces astaci TaxID=112090 RepID=W4H5F2_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 1.030e-9 Identity = 30/33 (90.91%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 715 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGAW 813 KR+DYL WDDYFMSVAFLS+MRSKDPSTQVGAW Sbjct: 35 KRKDYLSWDDYFMSVAFLSSMRSKDPSTQVGAW 67
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: A0A443RP84_9ACAR (Centrosomal protein of 44 kDa-like isoform X2 n=1 Tax=Dinothrombium tinctorium TaxID=1965070 RepID=A0A443RP84_9ACAR) HSP 1 Score: 67.0 bits (162), Expect = 1.250e-9 Identity = 29/33 (87.88%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 712 GKREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 810 GKREDYL WD+YFMS+A+LSAMRSKDPSTQVGA Sbjct: 10 GKREDYLQWDEYFMSIAYLSAMRSKDPSTQVGA 42
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: H3G722_PHYRM (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3G722_PHYRM) HSP 1 Score: 65.9 bits (159), Expect = 2.630e-9 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 1 Query: 715 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 810 KR DYL WDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 2 KRSDYLSWDDYFMSVAFLSAMRSKDPSTQVGA 33
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Match: D8LJR7_ECTSI (CMP/dCMP-type deaminase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJR7_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 3.240e-9 Identity = 31/32 (96.88%), Postives = 31/32 (96.88%), Query Frame = 1 Query: 715 KREDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 810 KR DYLVWDDYFMSVAFLSAMRSKDPSTQVGA Sbjct: 121 KRTDYLVWDDYFMSVAFLSAMRSKDPSTQVGA 152 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11469.953.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig11469.953.1 >prot_H-paniculata_contig11469.953.1 ID=prot_H-paniculata_contig11469.953.1|Name=mRNA_H-paniculata_contig11469.953.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=253bp MLKNRHCDHSACNIPSFLSIFGVLLAVLVCRVVARGTSPIHGGTNRWHSLback to top mRNA from alignment at H-paniculata_contig11469:2313..5753- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig11469.953.1 ID=mRNA_H-paniculata_contig11469.953.1|Name=mRNA_H-paniculata_contig11469.953.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=3441bp|location=Sequence derived from alignment at H-paniculata_contig11469:2313..5753- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig11469:2313..5753- >mRNA_H-paniculata_contig11469.953.1 ID=mRNA_H-paniculata_contig11469.953.1|Name=mRNA_H-paniculata_contig11469.953.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=1518bp|location=Sequence derived from alignment at H-paniculata_contig11469:2313..5753- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |