prot_H-paniculata_contig11307.839.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig11307.839.1 vs. uniprot
Match: A0A6H5KK33_9PHAE (C2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KK33_9PHAE) HSP 1 Score: 102 bits (253), Expect = 1.970e-23 Identity = 49/75 (65.33%), Postives = 59/75 (78.67%), Query Frame = 0 Query: 7 ETGIHQRREVRLKVLSQSVGRWSGPLPLASGLVRRAIEHGDVFLVVEESVCVANASWNSIWLETMPHKHVSSDTA 81 E+G R V L +SVGRWSGPLP+ASGLV+RA+E GD+FLV+E +V VAN SW+SIW ETMPHKHVSS +A Sbjct: 2260 ESGDAGARSVTLAGDLESVGRWSGPLPMASGLVKRAVERGDIFLVIESTVYVANVSWSSIWQETMPHKHVSSSSA 2334
BLAST of mRNA_H-paniculata_contig11307.839.1 vs. uniprot
Match: D8LEV4_ECTSI (C2 domain containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LEV4_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 5.830e-14 Identity = 33/49 (67.35%), Postives = 42/49 (85.71%), Query Frame = 0 Query: 23 QSVGRWSGPLPLASGLVRRAIEHGDVFLVVEESVCVANASWNSIWLETM 71 +SVGRWSGPLP+ASGLV+RA+E GD+FLV+E +V VAN SW+SI E + Sbjct: 5244 ESVGRWSGPLPMASGLVKRAVERGDIFLVIESTVYVANVSWSSILQEAV 5292 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig11307.839.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig11307.839.1 ID=prot_H-paniculata_contig11307.839.1|Name=mRNA_H-paniculata_contig11307.839.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=81bpback to top |