mRNA_H-paniculata_contig151.3026.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig151.3026.1 vs. uniprot
Match: D7FZS2_ECTSI (Ankyrin 2,3/unc44 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZS2_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 3.280e-10 Identity = 30/51 (58.82%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 34 GKGSNATFVDVVPFYNIRAKYLRPWGDTALSRPHHISAIP----DRTMASP 174 G G FVDVVPF NIRAKYLRPW DT LSRP+H++ P DR + +P Sbjct: 386 GGGGRGCFVDVVPFNNIRAKYLRPWNDTELSRPYHVAPSPTWRADRAVGTP 436
BLAST of mRNA_H-paniculata_contig151.3026.1 vs. uniprot
Match: A0A6H5KP45_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KP45_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 1.290e-9 Identity = 27/40 (67.50%), Postives = 30/40 (75.00%), Query Frame = 1 Query: 34 GKGSNATFVDVVPFYNIRAKYLRPWGDTALSRPHHISAIP 153 G G FVDVVPF NIRAKYLRPW DT LSRP+H++ P Sbjct: 204 GIGGRGCFVDVVPFNNIRAKYLRPWNDTELSRPYHVAPSP 243 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig151.3026.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig151.3026.1 >prot_H-paniculata_contig151.3026.1 ID=prot_H-paniculata_contig151.3026.1|Name=mRNA_H-paniculata_contig151.3026.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=72bp SGVEHLPSATDGKGSNATFVDVVPFYNIRAKYLRPWGDTALSRPHHISAIback to top mRNA from alignment at H-paniculata_contig151:5114..5330+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig151.3026.1 ID=mRNA_H-paniculata_contig151.3026.1|Name=mRNA_H-paniculata_contig151.3026.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=217bp|location=Sequence derived from alignment at H-paniculata_contig151:5114..5330+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig151:5114..5330+ >mRNA_H-paniculata_contig151.3026.1 ID=mRNA_H-paniculata_contig151.3026.1|Name=mRNA_H-paniculata_contig151.3026.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=432bp|location=Sequence derived from alignment at H-paniculata_contig151:5114..5330+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |