Gvermi7651.t1 (mRNA) Gracilaria vermiculophylla HapMaleFtJ_2017 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gvermi7651.t1 ID=Gvermi7651.t1|Name=Gvermi7651.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=mRNA|length=102bpback to top spliced messenger RNA >Gvermi7651.t1 ID=Gvermi7651.t1|Name=Gvermi7651.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=mRNA|length=306bp|location=Sequence derived from alignment at ScGOVlb_64:1298782..1299225+ (Gracilaria vermiculophylla HapMaleFtJ_2017 male)|Notes=Excludes all bases but those of type(s): exon. ATGCAGGTTGAGCAGTACAAAGCTTTGAGACAACACAGTATTGTTTTATCback to top protein sequence of Gvermi7651.t1 >Gvermi7651.t1 ID=Gvermi7651.t1|Name=Gvermi7651.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=polypeptide|length=102bp MQVEQYKALRQHSIVLSQSLGFLSKYVRKLKRSDGKVSMEFSDTRQSVEFback to top mRNA from alignment at ScGOVlb_64:1298782..1299225+ Legend: polypeptidestart_codonCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gvermi7651.t1 ID=Gvermi7651.t1|Name=Gvermi7651.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=mRNA|length=444bp|location=Sequence derived from alignment at ScGOVlb_64:1298782..1299225+ (Gracilaria vermiculophylla HapMaleFtJ_2017 male)back to top Coding sequence (CDS) from alignment at ScGOVlb_64:1298782..1299225+ >Gvermi7651.t1 ID=Gvermi7651.t1|Name=Gvermi7651.t1|organism=Gracilaria vermiculophylla HapMaleFtJ_2017 male|type=CDS|length=306bp|location=Sequence derived from alignment at ScGOVlb_64:1298782..1299225+ (Gracilaria vermiculophylla HapMaleFtJ_2017 male)back to top |