Ggra9817.t1 (mRNA) Gracilaria gracilis GNS1m male
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ggra9817.t1 ID=Ggra9817.t1|Name=Ggra9817.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=176bpback to top spliced messenger RNA >Ggra9817.t1 ID=Ggra9817.t1|Name=Ggra9817.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=528bp|location=Sequence derived from alignment at tig00000160_pilon:16819..17455+ (Gracilaria gracilis GNS1m male)|Notes=Excludes all bases but those of type(s): exon. ATGAGAACAATTTTACCGGTTGCGAGTTGCGTTCTTATATTGTTGGGTTTback to top protein sequence of Ggra9817.t1 >Ggra9817.t1 ID=Ggra9817.t1|Name=Ggra9817.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=176bp MRTILPVASCVLILLGFFAVRGLAQQTQPAHPPVVEAVAAEVVAAVGAPQback to top mRNA from alignment at tig00000160_pilon:16819..17455+ Legend: polypeptidestart_codonCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Ggra9817.t1 ID=Ggra9817.t1|Name=Ggra9817.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=637bp|location=Sequence derived from alignment at tig00000160_pilon:16819..17455+ (Gracilaria gracilis GNS1m male)back to top Coding sequence (CDS) from alignment at tig00000160_pilon:16819..17455+ >Ggra9817.t1 ID=Ggra9817.t1|Name=Ggra9817.t1|organism=Gracilaria gracilis GNS1m male|type=CDS|length=528bp|location=Sequence derived from alignment at tig00000160_pilon:16819..17455+ (Gracilaria gracilis GNS1m male)back to top |