Ggra10208.t1 (polypeptide) Gracilaria gracilis GNS1m male
Overview
Homology
BLAST of Ggra10208.t1 vs. uniprot
Match: A0A2V3ILH2 (C2H2-type domain-containing protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3ILH2_9FLOR) HSP 1 Score: 83.2 bits (204), Expect = 5.700e-15 Identity = 43/66 (65.15%), Postives = 51/66 (77.27%), Query Frame = 0 Query: 1 MQPNLPLGDMHAPTTTTSEAPSDKP-FRCHYVDCLRPFQRKTSLTNHLKAHKNANSRSINRSRRAR 65 M PN +G P+TT +EA + P F+CHY DC+R F+RKTSLTNHLKAHKN NSRSINRS+RAR Sbjct: 1 MHPNAHVGGFSTPSTTATEAHTGGPTFQCHYEDCMRIFRRKTSLTNHLKAHKNINSRSINRSKRAR 66 The following BLAST results are available for this feature:
BLAST of Ggra10208.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ggra10208.t1 ID=Ggra10208.t1|Name=Ggra10208.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=294bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|