Ggra9970.t1 (polypeptide) Gracilaria gracilis GNS1m male
Overview
Homology
BLAST of Ggra9970.t1 vs. uniprot
Match: A0A2V3IV39 (Ankyrin repeat domain-containing protein 50 n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IV39_9FLOR) HSP 1 Score: 83.6 bits (205), Expect = 4.290e-15 Identity = 43/121 (35.54%), Postives = 72/121 (59.50%), Query Frame = 0 Query: 29 NEIDRLWHKSQTTPVTIGNLLHVIKAENVTSFSSFLLGHKLLQIAVERNVIPKQQRRKFGGEQDYAFINLYLPISREYLSDEQKVLYFGTLKEAEEVGLILEGDIKLMKSVVTMRSKILET 149 N +++LW ++ LL ++++ +TSFSSF++ H LL +AV + +I K++ R GG +DY +YLP+++ L+ EQK L L AE++G I D +K V +RS+I E+ Sbjct: 722 NALEQLWITYASSVPPKNELLAALRSDQITSFSSFIMAHNLLLLAVRQRIIRKEEVRLLGGSRDYILHEVYLPVTKVDLTQEQKCLVAKVLSYAEKLGFI--RDATFVKVVAELRSEIRES 840 The following BLAST results are available for this feature:
BLAST of Ggra9970.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Ggra9970.t1 ID=Ggra9970.t1|Name=Ggra9970.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=208bpback to top |