Ggra9839.t1 (polypeptide) Gracilaria gracilis GNS1m male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Ggra9839.t1
Unique Name	Ggra9839.t1
Type	polypeptide
Organism	Gracilaria gracilis GNS1m male (Gracilaria gracilis GNS1m male (Slender Wart Weed))
Sequence length	202

Homology

The following BLAST results are available for this feature:

BLAST of Ggra9839.t1 vs. uniprot

BLAST of Ggra9839.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..18
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 106..121
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..151
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 33..55
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 89..103
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 56..73

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
tig00000170_pilon	contig	tig00000170_pilon:47835..48440 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria gracilis GNS1m male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Ggra9839.t1	Ggra9839.t1	Gracilaria gracilis GNS1m male	mRNA	tig00000170_pilon 47835..48440 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Ggra9839.t1 ID=Ggra9839.t1|Name=Ggra9839.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=202bp
MELPSKKQKTNNASYRHLFTFGNEAHTSPFPTHGKGHPSSQQFTFLGSSV
DLFRDSKQTSEGDVQHLRHSDGDHQMPQVAPQVAQLAIEHDSAEHEEKSR
DGVATLNDLSYPTNIEGSPSEQHEHNGYIPETEQQSYEEEEPAFQFPDDI
FSRPEALNEIAAQFVRNTAVEKLEEEWDRVDGVRDQMRRDFKIRRQKAVS
L*