Ggra987.t1 (mRNA) Gracilaria gracilis GNS1m male
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Ggra987.t1 ID=Ggra987.t1|Name=Ggra987.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=160bpback to top spliced messenger RNA >Ggra987.t1 ID=Ggra987.t1|Name=Ggra987.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=480bp|location=Sequence derived from alignment at tig00000027_pilon:78325..78865+ (Gracilaria gracilis GNS1m male)|Notes=Excludes all bases but those of type(s): exon. ATGTTGTTCTCTCTCGTATTCATTTCAGTGCTCCTCCATCTGAGCACCGGback to top protein sequence of Ggra987.t1 >Ggra987.t1 ID=Ggra987.t1|Name=Ggra987.t1|organism=Gracilaria gracilis GNS1m male|type=polypeptide|length=160bp MLFSLVFISVLLHLSTGSMIFCTEKGGCLLEDGSQLTCTGLPQKAGTQILback to top mRNA from alignment at tig00000027_pilon:78325..78865+ Legend: polypeptidestart_codonCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Ggra987.t1 ID=Ggra987.t1|Name=Ggra987.t1|organism=Gracilaria gracilis GNS1m male|type=mRNA|length=541bp|location=Sequence derived from alignment at tig00000027_pilon:78325..78865+ (Gracilaria gracilis GNS1m male)back to top Coding sequence (CDS) from alignment at tig00000027_pilon:78325..78865+ >Ggra987.t1 ID=Ggra987.t1|Name=Ggra987.t1|organism=Gracilaria gracilis GNS1m male|type=CDS|length=480bp|location=Sequence derived from alignment at tig00000027_pilon:78325..78865+ (Gracilaria gracilis GNS1m male)back to top |