Gchil7365.t1 (polypeptide) Gracilaria chilensis NLEC103_M9 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Gchil7365.t1
Unique Name	Gchil7365.t1
Type	polypeptide
Organism	Gracilaria chilensis NLEC103_M9 male (Gracilaria chilensis NLEC103_M9 male)
Sequence length	237

Homology

The following BLAST results are available for this feature:

BLAST of Gchil7365.t1 vs. uniprot

BLAST of Gchil7365.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 193..219
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 119..149
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 79..118
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 159..176
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 62..236
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 177..192

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
tig00000007_pilon	contig	tig00000007_pilon:709033..709743 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria chilensis NLEC103_M9 male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Gchil7365.t1	Gchil7365.t1	Gracilaria chilensis NLEC103_M9 male	mRNA	tig00000007_pilon 709033..709743 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Gchil7365.t1 ID=Gchil7365.t1|Name=Gchil7365.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=polypeptide|length=237bp
MDKEREDEMERRLRQTFDKRVPEGWFDWRGLQTNGSFFEQSSAPSSPYNS
LFVHDAQKLNCVEHICGGDGGGGGGGGDGDSEEEGRALAGECAREEGALE
RGAPDGAKLEKGEQEEDKQEKGGEDDEDEDDDDEDDDEDSDSDDSDDGAG
ALQEDFRQKVLNNQRHRELQLLRERRDDDDDDDDDDDDGNDEGNSNGNGN
GNGNGNGNGNGNGNGNGNGDYEGNEKGDGGGAEAAQ*