Gchil10939.t1 (mRNA) Gracilaria chilensis NLEC103_M9 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gchil10939.t1 ID=Gchil10939.t1|Name=Gchil10939.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=106bpback to top spliced messenger RNA >Gchil10939.t1 ID=Gchil10939.t1|Name=Gchil10939.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=318bp|location=Sequence derived from alignment at tig00004424_pilon:73242..73724- (Gracilaria chilensis NLEC103_M9 male)|Notes=Excludes all bases but those of type(s): exon. ATGCAGGGCATGCACCCCAGCAATCTTGCGCAGACCGGGGCGGGCGTCTAback to top protein sequence of Gchil10939.t1 >Gchil10939.t1 ID=Gchil10939.t1|Name=Gchil10939.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=polypeptide|length=106bp MQGMHPSNLAQTGAGVYPVRSMQGVPEAQAQAGFCQQIRDAQQAQAQAHHback to top mRNA from alignment at tig00004424_pilon:73242..73724- Legend: polypeptideCDSexonstart_codonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gchil10939.t1 ID=Gchil10939.t1|Name=Gchil10939.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=483bp|location=Sequence derived from alignment at tig00004424_pilon:73242..73724- (Gracilaria chilensis NLEC103_M9 male)back to top Coding sequence (CDS) from alignment at tig00004424_pilon:73242..73724- >Gchil10939.t1 ID=Gchil10939.t1|Name=Gchil10939.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=CDS|length=318bp|location=Sequence derived from alignment at tig00004424_pilon:73242..73724- (Gracilaria chilensis NLEC103_M9 male)back to top |