Gchil10469.t1 (mRNA) Gracilaria chilensis NLEC103_M9 male
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gchil10469.t1 ID=Gchil10469.t1|Name=Gchil10469.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=81bpback to top spliced messenger RNA >Gchil10469.t1 ID=Gchil10469.t1|Name=Gchil10469.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=243bp|location=Sequence derived from alignment at tig00000159_pilon:94253..94571+ (Gracilaria chilensis NLEC103_M9 male)|Notes=Excludes all bases but those of type(s): exon. ATGCATCCCACTCTTGCTCCACACCTACACCCCATGTGTCAAGAAGCAATback to top protein sequence of Gchil10469.t1 >Gchil10469.t1 ID=Gchil10469.t1|Name=Gchil10469.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=polypeptide|length=81bp MHPTLAPHLHPMCQEAIRNLKQCHSERRFAKFLGACNDAKAALDKCLSQEback to top mRNA from alignment at tig00000159_pilon:94253..94571+ Legend: polypeptidestart_codonCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gchil10469.t1 ID=Gchil10469.t1|Name=Gchil10469.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=mRNA|length=319bp|location=Sequence derived from alignment at tig00000159_pilon:94253..94571+ (Gracilaria chilensis NLEC103_M9 male)back to top Coding sequence (CDS) from alignment at tig00000159_pilon:94253..94571+ >Gchil10469.t1 ID=Gchil10469.t1|Name=Gchil10469.t1|organism=Gracilaria chilensis NLEC103_M9 male|type=CDS|length=243bp|location=Sequence derived from alignment at tig00000159_pilon:94253..94571+ (Gracilaria chilensis NLEC103_M9 male)back to top |