Gcaud9720.t1 (polypeptide) Gracilaria caudata M_176_S67 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	Gcaud9720.t1
Unique Name	Gcaud9720.t1
Type	polypeptide
Organism	Gracilaria caudata M_176_S67 male (Gracilaria caudata M_176_S67 male)
Sequence length	304

Homology

The following BLAST results are available for this feature:

BLAST of Gcaud9720.t1 vs. uniprot

BLAST of Gcaud9720.t1 vs. uniprot
Analysis Date: 2022-06-02 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-06-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 157..162
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 183..201
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 6..22
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 163..182
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 84..94
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 95..113
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 114..132
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 225..303
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 66..83
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 23..41
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 61..65
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 202..224
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 1..5
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 42..60
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 133..156
None	No IPR available	TMHMM	TMhelix		coord: 145..167
None	No IPR available	TMHMM	TMhelix		coord: 2..24
None	No IPR available	TMHMM	TMhelix		coord: 103..125
None	No IPR available	TMHMM	TMhelix		coord: 174..193
None	No IPR available	TMHMM	TMhelix		coord: 66..83
None	No IPR available	TMHMM	TMhelix		coord: 203..225

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
NODE_1969_length_7405_cov_4.748701	contig	NODE_1969_length_7405_cov_4.748701:1884..2795 +

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-06-01
Diamond blastp: OGS1.0 vs UniRef90	2022-06-02
Gracilaria caudata M_176_S67 male OGS1.0	2022-05-09

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
Gcaud9720.t1	Gcaud9720.t1	Gracilaria caudata M_176_S67 male	mRNA	NODE_1969_length_7405_cov_4.748701 1884..2795 +

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>Gcaud9720.t1 ID=Gcaud9720.t1|Name=Gcaud9720.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=304bp
MVFLSEYAVAVASLLIFSVYNIQMVNRASSASDFNRTADNHASLTTFSLL
LTYAATRMLLEDESPQAVTPVFLAVLFVMANIVKNGKYHTIEWINRISTM
LLVALCLGFFIVFKGLNFLAQIALLNKLDRQIQWYHVFFIWFSSWRWFFI
SFITALPVYTPTWGLLVMTIKIVLMWVFYAGSGTSVAASPWGSLDEILLE
RNALLSLIISLITIVIIADQLAAIGKAYELEHIKATGKNVEPRDWDELKT
AIFSIFEKARQRNFVADFSECFPYVNEKDIEDVLVEVEDTKPAYIEVEDA
RDA*