Gcaud1304.t1 (mRNA) Gracilaria caudata M_176_S67 male
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following intron feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >Gcaud1304.t1 ID=Gcaud1304.t1|Name=Gcaud1304.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=91bpback to top spliced messenger RNA >Gcaud1304.t1 ID=Gcaud1304.t1|Name=Gcaud1304.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=273bp|location=Sequence derived from alignment at NODE_1882_length_7904_cov_4.729809:439..775+ (Gracilaria caudata M_176_S67 male)|Notes=Excludes all bases but those of type(s): exon. TTCACAATACTTTCTGAGCAACTACAAGGTTATAGAAAGAAAAACTACCGback to top protein sequence of Gcaud1304.t1 >Gcaud1304.t1 ID=Gcaud1304.t1|Name=Gcaud1304.t1|organism=Gracilaria caudata M_176_S67 male|type=polypeptide|length=91bp FTILSEQLQGYRKKNYRKYILKAIKDRESKCAGAYKTEVDPRLCLILMLAback to top mRNA from alignment at NODE_1882_length_7904_cov_4.729809:439..775+ Legend: polypeptideCDSexonintronstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>Gcaud1304.t1 ID=Gcaud1304.t1|Name=Gcaud1304.t1|organism=Gracilaria caudata M_176_S67 male|type=mRNA|length=337bp|location=Sequence derived from alignment at NODE_1882_length_7904_cov_4.729809:439..775+ (Gracilaria caudata M_176_S67 male)back to top Coding sequence (CDS) from alignment at NODE_1882_length_7904_cov_4.729809:439..775+ >Gcaud1304.t1 ID=Gcaud1304.t1|Name=Gcaud1304.t1|organism=Gracilaria caudata M_176_S67 male|type=CDS|length=273bp|location=Sequence derived from alignment at NODE_1882_length_7904_cov_4.729809:439..775+ (Gracilaria caudata M_176_S67 male)back to top |