prot_F-serratus_M_contig93.20698.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig93.20698.1 vs. uniprot
Match: UPI00138FC94C (uncharacterized protein LOC116617085 n=1 Tax=Nematostella vectensis TaxID=45351 RepID=UPI00138FC94C) HSP 1 Score: 57.0 bits (136), Expect = 4.660e-8 Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 0 Query: 5 QPSRLMAFDIKTAVQEWFFDSDPVDNNGLLIKVEDEDLLGRDLRFYSNAYSDSDYHARIHVIC 67 +PS + FD+ AV++W S N GL+++V+DE + GR LRF SNA DS +HA IHV C Sbjct: 167 RPSGFVEFDVTRAVKDWAGGSP---NYGLVVRVKDESVDGRGLRFASNADPDSQHHAFIHVKC 226
BLAST of mRNA_F-serratus_M_contig93.20698.1 vs. uniprot
Match: A0A451CPM4_9GAMM (Disaggregatase related repeat-containing protein n=1 Tax=Candidatus Kentron sp. G TaxID=2126341 RepID=A0A451CPM4_9GAMM) HSP 1 Score: 53.5 bits (127), Expect = 5.680e-7 Identity = 27/63 (42.86%), Postives = 39/63 (61.90%), Query Frame = 0 Query: 5 QPSRLMAFDIKTAVQEWFFDSDPVDNNGLLIKVEDEDLLGRDLRFYSNAYSDSDYHARIHVIC 67 +PS M FD+ AV+ W ++ N GLL+ +E +GRD+RFYS YSD+D H + V+C Sbjct: 120 RPSGYMEFDVTPAVKNW---AEGERNYGLLVWAMNEYEVGRDIRFYSREYSDTDKHPVLKVLC 179
BLAST of mRNA_F-serratus_M_contig93.20698.1 vs. uniprot
Match: UPI00138FC51C (uncharacterized protein LOC116617081 n=1 Tax=Nematostella vectensis TaxID=45351 RepID=UPI00138FC51C) HSP 1 Score: 53.1 bits (126), Expect = 1.230e-6 Identity = 28/63 (44.44%), Postives = 40/63 (63.49%), Query Frame = 0 Query: 5 QPSRLMAFDIKTAVQEWFFDSDPVDNNGLLIKVEDEDLLGRDLRFYSNAYSDSDYHARIHVIC 67 +PS + FD+ AV++W S N G++++V++E + GR LRF SNA DS HA IHV C Sbjct: 165 RPSGFVEFDVTRAVRDWARGSP---NYGVVVRVQNESVEGRGLRFASNADRDSKRHAYIHVKC 224 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig93.20698.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig93.20698.1 ID=prot_F-serratus_M_contig93.20698.1|Name=mRNA_F-serratus_M_contig93.20698.1|organism=Fucus serratus male|type=polypeptide|length=69bpback to top |