prot_F-serratus_M_contig1071.698.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1071.698.1 vs. uniprot
Match: D7G4A6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4A6_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 5.990e-11 Identity = 35/97 (36.08%), Postives = 56/97 (57.73%), Query Frame = 0 Query: 67 GRAKSRQLENVVSARDFIDELSTEVEELENLVEETARSLGREAAQNQHAKLGKRLGKRVTDVLLHLDRVTGDDQVRTARRKQVDKALALGERVGNAI 163 G K R L N+ S R+F+D LS EV +LE + A + + A+ ++ + + + VT VL HLD+ TG D++ AR+KQ+ +A LG R+ + Sbjct: 35 GGTKRRMLGNIASGREFLDALSAEVADLEATIALAAEASDLDTARKENERKSREHDEHVTQVLTHLDKCTGGDEIGVARKKQIHRAEVLGLRISKIL 131 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1071.698.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1071.698.1 ID=prot_F-serratus_M_contig1071.698.1|Name=mRNA_F-serratus_M_contig1071.698.1|organism=Fucus serratus male|type=polypeptide|length=169bpback to top |