prot_F-serratus_M_contig1059.583.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1059.583.1 vs. uniprot
Match: D8LR13_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LR13_ECTSI) HSP 1 Score: 93.2 bits (230), Expect = 9.820e-22 Identity = 47/101 (46.53%), Postives = 73/101 (72.28%), Query Frame = 0 Query: 37 MSTSLFAKATGSMLGKYSVKVKKGNVV---EALDKIQERERLMRLDEMMAREAFYEKGFKKRIRKRKFNEWRNQYKAVMSQAKWITLLRMKGVPVPGENDG 134 MSTS A++ GS+LG++SVKVK +V +A+D+I+ RER++R+ E+M R ++EKG+ + R++ WRN++KA Q KW+TLL+ KGVP+PG+ G Sbjct: 1 MSTSWVARSAGSLLGRHSVKVKGDSVQKVNQAMDEIERRERMLRVPEVMERHRYHEKGYNRTRRQKSGKIWRNEFKAATKQLKWMTLLKEKGVPIPGQKVG 101 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1059.583.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1059.583.1 ID=prot_F-serratus_M_contig1059.583.1|Name=mRNA_F-serratus_M_contig1059.583.1|organism=Fucus serratus male|type=polypeptide|length=161bpback to top |