prot_F-serratus_M_contig99.21202.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig99.21202.1 vs. uniprot
Match: UPI001C26C866 (cytochrome b-c1 complex subunit 6-1, mitochondrial-like n=1 Tax=Salvia splendens TaxID=180675 RepID=UPI001C26C866) HSP 1 Score: 52.4 bits (124), Expect = 1.000e-7 Identity = 23/43 (53.49%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 3 EYKACIDRVEKKGFGT--CEPWFFDYLSCVDKCVAPKIMKVLK 43 EYK C++RV+ G C +FDY SCVDKCVAPK+ + LK Sbjct: 43 EYKQCVERVDSDDSGQKHCTGQYFDYWSCVDKCVAPKLFQELK 85
BLAST of mRNA_F-serratus_M_contig99.21202.1 vs. uniprot
Match: A0A0E0R4L3_ORYRU (UCR_hinge domain-containing protein n=2 Tax=Oryza TaxID=4527 RepID=A0A0E0R4L3_ORYRU) HSP 1 Score: 53.1 bits (126), Expect = 1.050e-7 Identity = 23/45 (51.11%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 1 MSEYKACIDRVEKKGFGT--CEPWFFDYLSCVDKCVAPKIMKVLK 43 + EY+ C+ RVEK G C +FDY SC+DKCVAPK+++ LK Sbjct: 75 LYEYEKCVKRVEKDDTGHKHCTGQYFDYWSCIDKCVAPKLLEKLK 119
BLAST of mRNA_F-serratus_M_contig99.21202.1 vs. uniprot
Match: A0A0Q3IT18_BRADI (UCR_hinge domain-containing protein n=1 Tax=Brachypodium distachyon TaxID=15368 RepID=A0A0Q3IT18_BRADI) HSP 1 Score: 52.8 bits (125), Expect = 1.060e-7 Identity = 23/45 (51.11%), Postives = 30/45 (66.67%), Query Frame = 0 Query: 1 MSEYKACIDRVEKKGFGT--CEPWFFDYLSCVDKCVAPKIMKVLK 43 + EY+ C+ RVE G C +FDYLSC+DKCVAPK+ + LK Sbjct: 59 LYEYERCVKRVESDDTGHKHCTGQYFDYLSCIDKCVAPKLFEKLK 103
BLAST of mRNA_F-serratus_M_contig99.21202.1 vs. uniprot
Match: A0A314XSR3_PRUYE (Cytochrome b-c1 complex subunit 6-like n=1 Tax=Prunus yedoensis var. nudiflora TaxID=2094558 RepID=A0A314XSR3_PRUYE) HSP 1 Score: 53.5 bits (127), Expect = 1.200e-7 Identity = 24/45 (53.33%), Postives = 30/45 (66.67%), Query Frame = 0 Query: 1 MSEYKACIDRVEKKGFGT--CEPWFFDYLSCVDKCVAPKIMKVLK 43 + EY+AC+ RVE G C +FDY+SCVDKCVAPK+ LK Sbjct: 34 LIEYQACVKRVEGDNNGEKHCTGQYFDYISCVDKCVAPKLFGALK 78
BLAST of mRNA_F-serratus_M_contig99.21202.1 vs. uniprot
Match: A0A6P4AWN7_ZIZJJ (Cytochrome b-c1 complex subunit 6 n=2 Tax=Ziziphus jujuba TaxID=326968 RepID=A0A6P4AWN7_ZIZJJ) HSP 1 Score: 51.6 bits (122), Expect = 1.400e-7 Identity = 22/45 (48.89%), Postives = 30/45 (66.67%), Query Frame = 0 Query: 1 MSEYKACIDRVE--KKGFGTCEPWFFDYLSCVDKCVAPKIMKVLK 43 + EY+AC+ R++ + G C +FDY SCVDKCVAPK+ LK Sbjct: 25 LLEYQACVKRIQGDESGHKHCTGQYFDYWSCVDKCVAPKLFSKLK 69 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig99.21202.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pages
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig99.21202.1 ID=prot_F-serratus_M_contig99.21202.1|Name=mRNA_F-serratus_M_contig99.21202.1|organism=Fucus serratus male|type=polypeptide|length=44bpback to top |