prot_F-serratus_M_contig99.21174.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig99.21174.1 vs. uniprot
Match: A0A6H5KC39_9PHAE (Aa_trans domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KC39_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 5.320e-9 Identity = 31/49 (63.27%), Postives = 38/49 (77.55%), Query Frame = 0 Query: 1 IIVLRHSLYALRGGDVMTAPFGQVAWITIGVLALIVIFVVVLDLFDVAQ 49 +IV+RHSLYALRG DVM A FGQVAW+T +LAL+V +V L+ VAQ Sbjct: 415 VIVMRHSLYALRGKDVMVAEFGQVAWVTFALLALVVGAMVGLNTVGVAQ 463
BLAST of mRNA_F-serratus_M_contig99.21174.1 vs. uniprot
Match: D7FZR9_ECTSI (Transmembrane amino acid transporter protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZR9_ECTSI) HSP 1 Score: 57.8 bits (138), Expect = 1.860e-8 Identity = 31/49 (63.27%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 1 IIVLRHSLYALRGGDVMTAPFGQVAWITIGVLALIVIFVVVLDLFDVAQ 49 +IV+RHSLYALRG DVM A FGQVAW+T +LAL V +V L+ VAQ Sbjct: 415 VIVMRHSLYALRGKDVMVAEFGQVAWVTFALLALAVGAMVGLNTVGVAQ 463 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig99.21174.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig99.21174.1 ID=prot_F-serratus_M_contig99.21174.1|Name=mRNA_F-serratus_M_contig99.21174.1|organism=Fucus serratus male|type=polypeptide|length=49bpback to top |