prot_F-serratus_M_contig94.20762.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig94.20762.1 vs. uniprot
Match: D7G8Z3_ECTSI (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8Z3_ECTSI) HSP 1 Score: 76.3 bits (186), Expect = 6.050e-13 Identity = 32/46 (69.57%), Postives = 38/46 (82.61%), Query Frame = 0 Query: 22 KLRKSCDPCSLAKRRCDGQPQCSLCVKKGIHCIYGERQKSGPKGRK 67 K+R+SCD C+LAKRRCDG+ +CSLC KK I C+Y RQKSGPKG K Sbjct: 23 KMRRSCDACALAKRRCDGELRCSLCCKKSIRCVYSTRQKSGPKGHK 68
BLAST of mRNA_F-serratus_M_contig94.20762.1 vs. uniprot
Match: A0A6H5JWH9_9PHAE (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWH9_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 2.860e-12 Identity = 32/49 (65.31%), Postives = 38/49 (77.55%), Query Frame = 0 Query: 22 KLRKSCDPCSLAKRRCDGQPQCSLCVKKGIHCIYGERQKSGPKGRKGLA 70 K+R+SCD C+LAKRRCDG+ +C LC KK I C+Y RQKSGPKG K A Sbjct: 23 KMRRSCDACALAKRRCDGELRCLLCCKKSIRCVYSTRQKSGPKGHKAPA 71 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig94.20762.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig94.20762.1 ID=prot_F-serratus_M_contig94.20762.1|Name=mRNA_F-serratus_M_contig94.20762.1|organism=Fucus serratus male|type=polypeptide|length=179bpback to top |