prot_F-serratus_M_contig1490.3374.1 (polypeptide) Fucus serratus male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_F-serratus_M_contig1490.3374.1
Unique Name	prot_F-serratus_M_contig1490.3374.1
Type	polypeptide
Organism	Fucus serratus male (Fucus serratus male (Toothed wrack or serrated wrack))
Sequence length	170

Homology

[Close]

BLAST of mRNA_F-serratus_M_contig1490.3374.1 vs. uniprot
Match: D7FJF0_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FJF0_ECTSI)

HSP 1 Score: 100 bits (249), Expect = 1.680e-23
Identity = 66/162 (40.74%), Postives = 91/162 (56.17%), Query Frame = 0

Query:   14 WIFLLSFADMVSDFTYFGELFEGDDVSGLVAYIVLAFAVCGLVSLLLSPPTMCGHALGVVVEDIPMTIATTAIQARIVGAKVTGWSTEAQVSYLFSVFALQQKLMYAGYAPFRRYQAREGRDKPRFCD--------VLLASVTVTLIALALAWIVAAIIIFF 167
            WI  LS AD++SDF YF EL+  ++V   VA+ VL FA+ GL+S L  P +  G A+ +  ED P+ I TTAIQA + GA V  W   A VSY+FS+FA+QQK+M  G     R       ++ R  +        V + S+      + LAW ++A IIFF
Sbjct:   17 WILALSVADILSDFLYFEELYTENNVPDGVAFAVLGFAIVGLMSFLSGPFSDIGTAVSISFEDFPIIIITTAIQAYLAGADVREWHAVAIVSYVFSMFAMQQKVMKLGLVKSIRDILNPRAEEERQAEIGPCYWWVVFVRSLAAVAFTVLLAWALSAFIIFF 178

The following BLAST results are available for this feature:

BLAST of mRNA_F-serratus_M_contig1490.3374.1 vs. uniprot

BLAST of mRNA_F-serratus_M_contig1490.3374.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
D7FJF0_ECTSI	1.680e-23	40.74	Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_H_REGION	Signal peptide H-region	coord: 7..18
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_N_REGION	Signal peptide N-region	coord: 1..6
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 39..60
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 61..141
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 24..38
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 142..167
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE	Signal Peptide	coord: 1..23
None	No IPR available	PHOBIUS	SIGNAL_PEPTIDE_C_REGION	Signal peptide C-region	coord: 19..23
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 168..169
None	No IPR available	TMHMM	TMhelix		coord: 143..165
None	No IPR available	TMHMM	TMhelix		coord: 7..24
None	No IPR available	TMHMM	TMhelix		coord: 39..61

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
F-serratus_M_contig1490	contig	F-serratus_M_contig1490:158571..159080 -

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0 of Fucus serratus MALE	2022-09-29
Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90	2022-09-16
OGS1.0 of Fucus serratus male	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_F-serratus_M_contig1490.3374.1	mRNA_F-serratus_M_contig1490.3374.1	Fucus serratus male	mRNA	F-serratus_M_contig1490 157269..177242 -

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_F-serratus_M_contig1490.3374.1 ID=prot_F-serratus_M_contig1490.3374.1|Name=mRNA_F-serratus_M_contig1490.3374.1|organism=Fucus serratus male|type=polypeptide|length=170bp
MSGSTSSCTVASIWIFLLSFADMVSDFTYFGELFEGDDVSGLVAYIVLAF
AVCGLVSLLLSPPTMCGHALGVVVEDIPMTIATTAIQARIVGAKVTGWST
EAQVSYLFSVFALQQKLMYAGYAPFRRYQAREGRDKPRFCDVLLASVTVT
LIALALAWIVAAIIIFFKL*