prot_F-serratus_M_contig1059.581.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5K214_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K214_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 1.710e-10 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 GLTFVCLSRAKRL DL++EPM+F+R+ LG T++ RL+EE RL LA T Sbjct: 46 GLTFVCLSRAKRLVDLIVEPMSFDRIGNLGNSSTMKGRLQEEVRLGELARTT 97
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6H5L976_9PHAE (ATP-dependent DNA helicase n=4 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L976_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 7.480e-10 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREE 57 GLTFVCLSRAKRL DL++EPM+F+R+ LG PT++ RL+EE Sbjct: 1527 GLTFVCLSRAKRLVDLMVEPMSFDRIGNLGNSPTMKARLQEE 1568
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI000C038F98 (ATP-dependent DNA helicase PIF6-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C038F98) HSP 1 Score: 55.1 bits (131), Expect = 1.580e-7 Identity = 27/56 (48.21%), Postives = 39/56 (69.64%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGETLHHH 71 GL ++ LSR ++L+DL+IEPM FERL + + + RL EE RL LA +TLH++ Sbjct: 107 GLAYIALSRVRKLSDLVIEPMGFERLQSIKKTSNYKFRLLEEARLNILAEKTLHNY 162
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A6S7JIW3_PARCT (ATP-dependent DNA helicase n=1 Tax=Paramuricea clavata TaxID=317549 RepID=A0A6S7JIW3_PARCT) HSP 1 Score: 56.2 bits (134), Expect = 2.060e-7 Identity = 28/53 (52.83%), Postives = 41/53 (77.36%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGETL 68 G+T+V LSRA+ LT L+IEPMT++RLS + + +L RL+EE+RL+ +A TL Sbjct: 1064 GITYVALSRARNLTSLVIEPMTYDRLSSIKKMQSLSYRLQEEKRLQVIANLTL 1116
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A7D9JY90_PARCT (UvrD_C_2 domain-containing protein (Fragment) n=1 Tax=Paramuricea clavata TaxID=317549 RepID=A0A7D9JY90_PARCT) HSP 1 Score: 53.1 bits (126), Expect = 2.100e-7 Identity = 26/52 (50.00%), Postives = 40/52 (76.92%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGET 67 G+T+V +SRA+ L L+IEPMTF+RL+ + + +L+ RL EE+RL+A+A T Sbjct: 40 GMTYVAISRARNLLSLIIEPMTFDRLTCIKKNESLQYRLEEEKRLQAIANFT 91
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI00077A45EF (ATP-dependent DNA helicase PIF7-like n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077A45EF) HSP 1 Score: 54.3 bits (129), Expect = 9.720e-7 Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGETLHHHGGV 74 GL +V LSR +R+TDL+I+PM+FERL L + + RL EE RL LA T+ H G+ Sbjct: 702 GLAYVALSRVRRITDLVIKPMSFERLHLLKKTSNYKFRLLEEARLDKLAQRTVESHIGL 760
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A7J6WDW9_THATH (Atp-dependent dna helicase pif1 n=1 Tax=Thalictrum thalictroides TaxID=46969 RepID=A0A7J6WDW9_THATH) HSP 1 Score: 52.4 bits (124), Expect = 2.140e-6 Identity = 30/50 (60.00%), Postives = 37/50 (74.00%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPM-TFERLSKLGEKPTLRLRLREEERLRALA 64 GLTFV LSR ++L+DL PM TFERL K+G+ L+ RL EEERLR +A Sbjct: 132 GLTFVALSRTRKLSDLAFSPMFTFERLHKIGKCAGLKPRLDEEERLRIMA 181
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI000C045087 (uncharacterized protein LOC111325086 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C045087) HSP 1 Score: 53.1 bits (126), Expect = 2.520e-6 Identity = 31/58 (53.45%), Postives = 39/58 (67.24%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRAL---AGETLHH 70 G+T+V LSR KRL DL+IEPMTFERL + L+ RL EE+RL +L A + HH Sbjct: 1133 GMTYVALSRVKRLQDLIIEPMTFERLQAYKKSNFLKYRLIEEKRLDSLSLNASKNGHH 1190
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: A0A3M6TBZ5_POCDA (ATP-dependent DNA helicase n=2 Tax=Pocillopora damicornis TaxID=46731 RepID=A0A3M6TBZ5_POCDA) HSP 1 Score: 53.1 bits (126), Expect = 2.530e-6 Identity = 31/58 (53.45%), Postives = 39/58 (67.24%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRAL---AGETLHH 70 G+T+V LSR KRL DL+IEPMTFERL + L+ RL EE+RL +L A + HH Sbjct: 1078 GMTYVALSRVKRLQDLIIEPMTFERLQAYKKSNFLKYRLIEEKRLDSLSLNASKNGHH 1135
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Match: UPI000A2A6B3A (uncharacterized protein LOC110247455 n=1 Tax=Exaiptasia diaphana TaxID=2652724 RepID=UPI000A2A6B3A) HSP 1 Score: 52.4 bits (124), Expect = 4.630e-6 Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 0 Query: 16 GLTFVCLSRAKRLTDLLIEPMTFERLSKLGEKPTLRLRLREEERLRALAGETLHHH 71 G+++V +SR K L+ L+IEPMTFERL+ + TL RL EE RL LA T H Sbjct: 658 GISYVAISRVKTLSSLVIEPMTFERLTAIKSSTTLHYRLEEESRLDYLAESTRASH 713 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1059.581.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1059.581.1 ID=prot_F-serratus_M_contig1059.581.1|Name=mRNA_F-serratus_M_contig1059.581.1|organism=Fucus serratus male|type=polypeptide|length=76bpback to top |