prot_F-serratus_M_contig1010.205.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5JUS2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUS2_9PHAE) HSP 1 Score: 100 bits (248), Expect = 6.250e-24 Identity = 48/70 (68.57%), Postives = 54/70 (77.14%), Query Frame = 0 Query: 1 VPIAPFETSWSTTGDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 VPI+P +T+W D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 169 VPISPVDTTWQ----DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 234
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5JFG8_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFG8_9PHAE) HSP 1 Score: 100 bits (248), Expect = 4.270e-23 Identity = 48/70 (68.57%), Postives = 54/70 (77.14%), Query Frame = 0 Query: 1 VPIAPFETSWSTTGDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 VPI+P +T+W D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 343 VPISPVDTTWQ----DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 408
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5K4U7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4U7_9PHAE) HSP 1 Score: 100 bits (248), Expect = 4.700e-23 Identity = 48/70 (68.57%), Postives = 54/70 (77.14%), Query Frame = 0 Query: 1 VPIAPFETSWSTTGDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 VPI+P +T+W D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 60 VPISPVDTTWQ----DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 125
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5L976_9PHAE (ATP-dependent DNA helicase n=4 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L976_9PHAE) HSP 1 Score: 100 bits (248), Expect = 6.620e-23 Identity = 48/70 (68.57%), Postives = 54/70 (77.14%), Query Frame = 0 Query: 1 VPIAPFETSWSTTGDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 VPI+P +T+W D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 1474 VPISPVDTTWQ----DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 1539
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5JMH2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMH2_9PHAE) HSP 1 Score: 94.7 bits (234), Expect = 8.150e-23 Identity = 45/61 (73.77%), Postives = 48/61 (78.69%), Query Frame = 0 Query: 10 WSTTGDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 WST D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 67 WSTGRKDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 127
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5KSF1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSF1_9PHAE) HSP 1 Score: 92.0 bits (227), Expect = 1.820e-22 Identity = 43/57 (75.44%), Postives = 47/57 (82.46%), Query Frame = 0 Query: 14 GDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 G+D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 7 GEDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 63
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5KFN2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFN2_9PHAE) HSP 1 Score: 92.4 bits (228), Expect = 3.100e-22 Identity = 43/58 (74.14%), Postives = 48/58 (82.76%), Query Frame = 0 Query: 13 TGDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 +G+D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 4 SGEDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 61
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5KCP5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCP5_9PHAE) HSP 1 Score: 92.4 bits (228), Expect = 6.360e-22 Identity = 43/58 (74.14%), Postives = 48/58 (82.76%), Query Frame = 0 Query: 13 TGDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 +G+D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 4 SGEDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 61
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5KN08_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KN08_9PHAE) HSP 1 Score: 92.4 bits (228), Expect = 6.280e-21 Identity = 43/58 (74.14%), Postives = 48/58 (82.76%), Query Frame = 0 Query: 13 TGDDRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 +G+D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 4 SGEDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 61
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Match: A0A6H5K214_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K214_9PHAE) HSP 1 Score: 89.0 bits (219), Expect = 2.610e-20 Identity = 42/55 (76.36%), Postives = 45/55 (81.82%), Query Frame = 0 Query: 16 DRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRL 70 D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL Sbjct: 4 DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRL 58 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1010.205.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1010.205.1 ID=prot_F-serratus_M_contig1010.205.1|Name=mRNA_F-serratus_M_contig1010.205.1|organism=Fucus serratus male|type=polypeptide|length=73bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|