prot_F-serratus_M_contig1009.188.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5KSF1_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KSF1_9PHAE) HSP 1 Score: 102 bits (255), Expect = 4.340e-26 Identity = 48/66 (72.73%), Postives = 55/66 (83.33%), Query Frame = 0 Query: 45 DRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 9 DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 74
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5KFN2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFN2_9PHAE) HSP 1 Score: 102 bits (255), Expect = 1.090e-25 Identity = 48/66 (72.73%), Postives = 55/66 (83.33%), Query Frame = 0 Query: 45 DRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 7 DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 72
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5KCP5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KCP5_9PHAE) HSP 1 Score: 102 bits (255), Expect = 2.330e-25 Identity = 48/66 (72.73%), Postives = 55/66 (83.33%), Query Frame = 0 Query: 45 DRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 7 DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 72
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5JMH2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JMH2_9PHAE) HSP 1 Score: 102 bits (255), Expect = 2.390e-25 Identity = 48/66 (72.73%), Postives = 55/66 (83.33%), Query Frame = 0 Query: 45 DRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 73 DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 138
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5K214_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K214_9PHAE) HSP 1 Score: 102 bits (255), Expect = 4.520e-25 Identity = 48/66 (72.73%), Postives = 55/66 (83.33%), Query Frame = 0 Query: 45 DRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 4 DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLIVEPMSFD 69
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5JUS2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JUS2_9PHAE) HSP 1 Score: 104 bits (260), Expect = 4.570e-25 Identity = 50/73 (68.49%), Postives = 57/73 (78.08%), Query Frame = 0 Query: 38 PADAAAADRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 P D D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 173 PVDTTWQDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 245
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5KN08_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KN08_9PHAE) HSP 1 Score: 102 bits (255), Expect = 2.970e-24 Identity = 48/66 (72.73%), Postives = 55/66 (83.33%), Query Frame = 0 Query: 45 DRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 7 DGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 72
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5JFG8_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFG8_9PHAE) HSP 1 Score: 104 bits (260), Expect = 3.840e-24 Identity = 50/73 (68.49%), Postives = 57/73 (78.08%), Query Frame = 0 Query: 38 PADAAAADRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 P D D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 347 PVDTTWQDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 419
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5K4U7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4U7_9PHAE) HSP 1 Score: 104 bits (260), Expect = 4.320e-24 Identity = 50/73 (68.49%), Postives = 57/73 (78.08%), Query Frame = 0 Query: 38 PADAAAADRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 P D D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 64 PVDTTWQDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 136
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Match: A0A6H5L976_9PHAE (ATP-dependent DNA helicase n=4 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L976_9PHAE) HSP 1 Score: 104 bits (260), Expect = 7.200e-24 Identity = 50/73 (68.49%), Postives = 57/73 (78.08%), Query Frame = 0 Query: 38 PADAAAADRGCETRRQLPLALCWSITMHKSQGQTLDKAVVDLGRSEATAGLTFVCLSRAKRLTDLLIEPMTFE 110 P D D G + R QLPL LCW+ITMHKSQGQTL KAV+DLG EA GLTFVCLSRAKRL DL++EPM+F+ Sbjct: 1478 PVDTTWQDGGTQVRTQLPLRLCWAITMHKSQGQTLAKAVIDLGPKEACTGLTFVCLSRAKRLVDLMVEPMSFD 1550 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1009.188.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1009.188.1 ID=prot_F-serratus_M_contig1009.188.1|Name=mRNA_F-serratus_M_contig1009.188.1|organism=Fucus serratus male|type=polypeptide|length=110bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|