prot_F-serratus_M_contig1009.187.1 (polypeptide) Fucus serratus male
Overview
Homology
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: A0A6H5K661_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K661_9PHAE) HSP 1 Score: 79.7 bits (195), Expect = 6.780e-14 Identity = 31/52 (59.62%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 145 STIGACIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRDL 196 ST G+CIVCF DY+ G+ +C+L CGH YHA CIDEW D CPLCK D+ Sbjct: 254 STRGSCIVCFGDYTYGEELCRLRCGHLYHAKCIDEWLDGENHGWCPLCKTDI 305
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: D8LSX3_ECTSI (RING-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSX3_ECTSI) HSP 1 Score: 79.3 bits (194), Expect = 8.820e-14 Identity = 31/52 (59.62%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 145 STIGACIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRDL 196 ST G+CIVCF DY+ G+ +C+L CGH YHA CIDEW D CPLCK D+ Sbjct: 247 STGGSCIVCFGDYTYGEELCRLRCGHLYHAKCIDEWLDGENHGWCPLCKTDI 298
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: A0A7R9YY65_9CHLO (Hypothetical protein n=1 Tax=Chlamydomonas euryale TaxID=1486919 RepID=A0A7R9YY65_9CHLO) HSP 1 Score: 67.8 bits (164), Expect = 4.140e-10 Identity = 28/49 (57.14%), Postives = 32/49 (65.31%), Query Frame = 0 Query: 150 CIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRDLWE 198 C VC D+S GD + LPCGH +HA CID W DR CPLC+R LWE Sbjct: 175 CTVCLIDFSLGDMLRTLPCGHEFHAECIDSWMDRN--LTCPLCRRTLWE 221
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: A0A1X2GNB5_9FUNG (RING-type domain-containing protein n=1 Tax=Hesseltinella vesiculosa TaxID=101127 RepID=A0A1X2GNB5_9FUNG) HSP 1 Score: 66.6 bits (161), Expect = 2.830e-9 Identity = 26/47 (55.32%), Postives = 32/47 (68.09%), Query Frame = 0 Query: 149 ACIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRD 195 AC++C DD+++GD V +LPCGH YH CID W S CPLCK D Sbjct: 168 ACVICLDDFTQGDTVRKLPCGHEYHCECIDPWLTIKSAS-CPLCKHD 213
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: A0A8H7VB49_9FUNG (RING-type domain-containing protein n=1 Tax=Mucor circinatus TaxID=2054153 RepID=A0A8H7VB49_9FUNG) HSP 1 Score: 65.9 bits (159), Expect = 6.880e-9 Identity = 30/72 (41.67%), Postives = 40/72 (55.56%), Query Frame = 0 Query: 149 ACIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRDLWEELLGASAITTGVAEGPVAENVG 220 +C++C D++S GD V +LPCGH YH CID W S CPLCK D L IT+ + P + +G Sbjct: 410 SCVICLDEFSSGDTVRKLPCGHEYHCECIDPWLTIKSAS-CPLCKHDC---SLDVPKITSDIEMQPDSREIG 477
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: V4MRY3_EUTSA (RING-type domain-containing protein n=2 Tax=Eutrema salsugineum TaxID=72664 RepID=V4MRY3_EUTSA) HSP 1 Score: 65.1 bits (157), Expect = 1.050e-8 Identity = 24/47 (51.06%), Postives = 34/47 (72.34%), Query Frame = 0 Query: 149 ACIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRD 195 +C +C +DYS GD++ LPCGH YHA C+D W + ++ CP+CKRD Sbjct: 230 SCAICLEDYSVGDKLRVLPCGHKYHAACVDSWLT-SWRTFCPVCKRD 275
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: U6M9P5_EIMMA (Zinc finger (C3HC4 RING finger) protein, putative n=1 Tax=Eimeria maxima TaxID=5804 RepID=U6M9P5_EIMMA) HSP 1 Score: 65.5 bits (158), Expect = 1.050e-8 Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 150 CIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRDLWEEL 200 C +CFD+Y+ GD +LPC H++H CIDEW R+ S CP+CK DL EL Sbjct: 1001 CSICFDEYNHGDEQRRLPCTHSFHKDCIDEWLKRS--SFCPICKYDLNREL 1049
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: A0A1J4KXD8_9EUKA (RING-type domain-containing protein n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4KXD8_9EUKA) HSP 1 Score: 63.5 bits (153), Expect = 1.680e-8 Identity = 23/50 (46.00%), Postives = 36/50 (72.00%), Query Frame = 0 Query: 150 CIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRDLWEE 199 C +C+++ RG++VC+LPC H +H VC+ EWF R +S CP+C+ L E+ Sbjct: 183 CSICYEELKRGEKVCELPCKHIFHDVCVREWFQR--ESNCPMCRLVLGEK 230
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: A0A1X2HAD4_SYNRA (RING-type domain-containing protein n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2HAD4_SYNRA) HSP 1 Score: 64.3 bits (155), Expect = 1.940e-8 Identity = 32/76 (42.11%), Postives = 41/76 (53.95%), Query Frame = 0 Query: 128 ADHKRSRGSTCPDSSQWSTIG--------ACIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRD 195 ADH R +Q +T+G AC++C D++S G+ V +LPCGH YH CID W S CPLCK D Sbjct: 199 ADHARPLA-----EAQTATLGDAPANAEEACVICLDEFSSGETVRRLPCGHEYHCECIDPWLTVKSAS-CPLCKHD 268
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Match: A0A485KSF0_9STRA (Aste57867_11189 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KSF0_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 1.940e-8 Identity = 26/57 (45.61%), Postives = 35/57 (61.40%), Query Frame = 0 Query: 140 DSSQWSTIGACIVCFDDYSRGDRVCQLPCGHTYHAVCIDEWFDRTGQSCCPLCKRDL 196 D + + C +C D+S + + QLPCGHTYH CIDEW ++ CPLCKRD+ Sbjct: 469 DKTNTGSSDGCSICLVDFSENEVLRQLPCGHTYHPACIDEWLVKS--PACPLCKRDV 523 The following BLAST results are available for this feature:
BLAST of mRNA_F-serratus_M_contig1009.187.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Fucus serratus MALE vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Fucus serratus MALE
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_F-serratus_M_contig1009.187.1 ID=prot_F-serratus_M_contig1009.187.1|Name=mRNA_F-serratus_M_contig1009.187.1|organism=Fucus serratus male|type=polypeptide|length=225bpback to top |